KEGG   Methanocaldococcus sp. FS406-22: MFS40622_1697
Entry
MFS40622_1697     CDS       T01175                                 

Name
(GenBank) deoxycytidine triphosphate deaminase
  KO
K09887  dCTP deaminase (dUMP-forming) [EC:3.5.4.30]
Organism
mfs  Methanocaldococcus sp. FS406-22
Pathway
mfs00240  Pyrimidine metabolism
mfs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mfs00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    MFS40622_1697
Enzymes [BR:mfs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.30  dCTP deaminase (dUMP-forming)
     MFS40622_1697
SSDB
Motif
Pfam: dUTPase DCD
Other DBs
NCBI-ProteinID: ADC70368
UniProt: D3S6A4
LinkDB
Position
complement(1651211..1651843)
AA seq 210 aa
MILSDKDIIDYVTSKRIIIEPFNKDFVGPCSYDVTLGDEFIIYDDEVYDLSKELNYKRIK
IKNSILVCPLNYNLTEEKINYFKEKYDVDYVVEGGVLGTTNEYIELPNDICAQYQGRSSL
GRVFLTSHQTAGWIDAGFKGKITLEIVAFDRPVILYKNQRIGQLIFSKLLSPADVGYSER
KSSKYTYQKTVMPSLIHLDNHNKKIKNKKF
NT seq 633 nt   +upstreamnt  +downstreamnt
atgattctaagcgataaagacattattgactatgttacatcaaaaaggattattattgag
ccatttaacaaagacttcgtagggccttgctcatacgatgtaaccttaggagatgaattt
ataatctatgatgatgaagtttatgatttgtcaaaagagctaaattacaaaagaataaag
ataaaaaattctattttagtttgccctctaaactacaatttaactgaagaaaaaatcaac
tattttaaagagaaatatgatgttgattacgttgttgaaggaggagttttaggtacaaca
aatgagtatattgagcttccaaatgatatatgtgcccaataccaaggtagaagtagttta
ggaagagtttttttaacctcccaccaaactgctggatggattgatgctggttttaaggga
aagataactttggagattgtagcttttgataggccagttattttatataaaaatcagaga
attgggcagttaatatttagcaagttgttatctccagcagatgttggttattcagagagg
aaaagctctaaatatacctatcaaaaaacagtaatgccttctttaatccatttagacaat
cataataaaaaaataaaaaataaaaaattttaa

DBGET integrated database retrieval system