Corallococcus macrosporus HW-1: LILAB_13330 Help Entry LILAB_13330       CDS       T01558                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mfu  Corallococcus macrosporus HW-1 Pathway mfu01100   Metabolic pathways mfu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mfu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LILAB_13330    00074 Mycolic acid biosynthesis     LILAB_13330   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LILAB_13330 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF6457 Motif Other DBs NCBI-ProteinID:  AEI64573 UniProt:  F8CAB6 LinkDB All DBs Position 3154992..3155273 Genome browser AA seq 93 aa AA seqDB search MAEPELEVLAEIHRIVTDELEWKGAVEPGQDLVRDLQLDSLGLTVLAVGLENRFRIRLSE EDAQGVRTVGDLARLVARRVAAPAEPLAEEALP NT seq 282 nt NT seq  +upstreamnt  +downstreamnt gtggctgagcccgaactggaggtcctggcggagattcaccgcatcgtcaccgacgagctg gagtggaagggcgcggtcgagccgggacaggacctggtgcgcgacctccagttggacagc ctggggctcacggtgttggcggtcgggctggagaatcgcttccgcatccggctgtccgaa gaggatgcgcagggcgtgcgcacggtgggggacctggcgaggctggtggctcggcgcgtc gcggcgccggcggagcccctggcggaggaggccctcccgtga

DBGET integrated database retrieval system