Corallococcus macrosporus HW-1: LILAB_32450 Help Entry LILAB_32450       CDS       T01558                                  Name (GenBank) GrxC family glutaredoxin   KO K03676   glutaredoxin 3 Organism mfu  Corallococcus macrosporus HW-1 Brite KEGG Orthology (KO) [BR:mfu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mfu03110]     LILAB_32450 Chaperones and folding catalysts [BR:mfu03110]  Protein folding catalysts   Protein disulfide isomerase    LILAB_32450 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Glrx-like GST_N_3 SH3BGR GST_N_2 Thioredoxin_2 Motif Other DBs NCBI-ProteinID:  AEI68371 UniProt:  F8CAZ0 LinkDB All DBs Position 7990032..7990289 Genome browser AA seq 85 aa AA seqDB search MKPVKIFTTTYCGYCVRAKDLLKRKGVDYEEVDVTGDDDLRARLVEMSGGQRTVPQIFIG DTHVGGYSDLSRLDSEGRLEPMLQA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt gtgaagcccgtgaagatttttacgaccacctactgtggctactgcgtccgcgccaaggac ctgctcaagcgcaagggcgtggattacgaggaggtggacgtcaccggagacgatgacctg cgcgccaggctcgtggagatgagcggcggccagcgcaccgtgccgcaaatcttcatcggc gacacgcacgtcggcggctactcggacctgtcccgcctggactccgagggccgcctggag ccgatgctccaggcctga

DBGET integrated database retrieval system