KEGG   Methylobacterium fujisawaense: ABC766_10015
Entry
ABC766_10015      CDS       T10654                                 
Name
(GenBank) aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
mfuj  Methylobacterium fujisawaense
Pathway
mfuj00260  Glycine, serine and threonine metabolism
mfuj00261  Monobactam biosynthesis
mfuj00270  Cysteine and methionine metabolism
mfuj00300  Lysine biosynthesis
mfuj01100  Metabolic pathways
mfuj01110  Biosynthesis of secondary metabolites
mfuj01120  Microbial metabolism in diverse environments
mfuj01210  2-Oxocarboxylic acid metabolism
mfuj01230  Biosynthesis of amino acids
Module
mfuj_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
mfuj_M00017  Methionine biosynthesis, aspartate => homoserine => methionine
mfuj_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mfuj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABC766_10015
   00270 Cysteine and methionine metabolism
    ABC766_10015
   00300 Lysine biosynthesis
    ABC766_10015
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    ABC766_10015
Enzymes [BR:mfuj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     ABC766_10015
SSDB
Motif
Pfam: AA_kinase ACT_9 ACT ACT_7 ACT_AHAS_ss ACT_6
Other DBs
NCBI-ProteinID: XAP12000
LinkDB
Position
complement(2115061..2116296)
AA seq 411 aa
MPRLVMKFGGTSVANVDRIRNVARHVAREVAAGYDVAVIVSAMSGKTNELVDWVKDANAL
YDPREYDAVVASGELVTAGLLAIALQKDGVKARSWQGWQIPVVTSDAHGSARIAEIDPKN
LEAGFAKGEVAVIAGFQGVHAETGRVTTLGRGGSDTSAVAVAAAIGAERCDIYTDVDGVY
TTDPRIVPKARRMERVTFEEMLEMASLGAKVLQVRSVELAMVHRVPTTVRSSFDPPDAAR
PGTLICDEDDIVEQQIITGIAFSRDEAQITLRRVKDSPGVAAAIFGPLADANINVDMIIQ
TVSGDQSTTDMTFTVPASEYQRSRAILDEARTQIGYAQIEGATDVVKVSAIGVGMRSHAG
VAAKAFRALAEKGINIRAITTSEIKFSVLIDAAYTELAVRTLHSLYGLDQA
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgccccgtctggtgatgaaattcggcggcacctccgtcgccaacgtcgaccgcatccgc
aacgtggcgcgccacgtcgcccgcgaggtggcggccggctacgacgttgccgtgatcgtc
tcggccatgtcaggcaagaccaacgagctggtcgactgggtcaaggacgcgaacgcgctc
tacgacccacgggaatacgacgccgtcgtggcctcgggcgaactcgtcaccgcgggcctc
ctggcgatcgccctccagaaggacggggtcaaggcccgctcctggcagggctggcagatt
ccggtcgtgacctcggacgcccatggctcggcgcggattgccgagatcgatcccaagaac
ctcgaggcgggtttcgcaaagggcgaggtcgcggtgatcgccggctttcagggcgtccat
gccgagaccggccgcgtgacgacgctgggccgtggcggctccgacacctcggcggtggcg
gtcgcggccgcgatcggggccgagcgctgcgacatctacacggacgtggacggcgtctac
accaccgatccgcgcatcgtgccgaaggcccgccgcatggagcgggtgaccttcgaagaa
atgctggagatggcctcgctgggcgccaaggtgctgcaggtccgctcggtggagcttgcc
atggtccaccgggtgccgaccacggtccggtcctccttcgatccgccggacgccgcgcgc
ccgggcaccctcatctgcgacgaggacgacatcgtggaacagcagatcatcaccgggatc
gccttctcccgggacgaggcgcagatcaccctgcgccgtgtcaaggacagccccggcgtg
gccgccgcgatcttcgggccgctggccgacgccaacatcaacgtcgacatgatcatccag
accgtgtcgggcgaccagtcgaccaccgacatgaccttcacggtgccggcctccgagtac
cagcgctcgcgcgccatcctcgacgaggcccgcacgcagatcggctacgcccagatcgag
ggggccaccgatgttgtgaaggtatcggcgatcggcgtcggcatgcgcagccatgcgggc
gtggccgccaaggcgttcagggcgcttgccgagaaggggatcaacatccgcgcgatcacc
acttcggagatcaagttctccgtgctgatcgacgccgcctatacggagcttgccgtgcgc
acgcttcactcgctatacggcctggaccaggcctga

DBGET integrated database retrieval system