Methanothermus fervidus: Mfer_0287 Help Entry Mfer_0287         CDS       T01351                                  Name (GenBank) LSU ribosomal protein L40E   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism mfv  Methanothermus fervidus Pathway mfv03010   Ribosome Brite KEGG Orthology (KO) [BR:mfv00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Mfer_0287   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Mfer_0287  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mfv03011]     Mfer_0287    04121 Ubiquitin system [BR:mfv04121]     Mfer_0287 Ribosome [BR:mfv03011]  Ribosomal proteins   Eukaryotes    Large subunit     Mfer_0287   Archaea     Mfer_0287 Ubiquitin system [BR:mfv04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Mfer_0287 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 DZR Zn_ribbon_3 Motif Other DBs NCBI-ProteinID:  ADP77090 UniProt:  E3GXQ8 LinkDB All DBs Position complement(276413..276559) Genome browser AA seq 48 aa AA seqDB search MARFEVAEKRLFNVKICLRCNARNAPKAKKCRKCGYKGLRFKAKEPRG NT seq 147 nt NT seq  +upstreamnt  +downstreamnt atggctagatttgaggtggcagaaaaaagactttttaacgtcaaaatatgtcttcgatgc aatgcaagaaatgcacctaaagcaaaaaaatgtagaaaatgtggttataagggcttaagg tttaaagcaaaagaacctagaggataa

DBGET integrated database retrieval system