Methanothermus fervidus: Mfer_0438 Help Entry Mfer_0438         CDS       T01351                                  Name (GenBank) SSU ribosomal protein S27AE   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mfv  Methanothermus fervidus Pathway mfv03010   Ribosome Brite KEGG Orthology (KO) [BR:mfv00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Mfer_0438   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Mfer_0438  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mfv03011]     Mfer_0438    04121 Ubiquitin system [BR:mfv04121]     Mfer_0438   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mfv04147]     Mfer_0438 Ribosome [BR:mfv03011]  Ribosomal proteins   Eukaryotes    Small subunit     Mfer_0438   Archaea     Mfer_0438 Ubiquitin system [BR:mfv04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Mfer_0438 Exosome [BR:mfv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Mfer_0438   Exosomal proteins of colorectal cancer cells    Mfer_0438 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e Zn_ribbon_Nudix Zn_Ribbon_TF Zn_ribbon_IS1595 Zn_ribbon_NUD Motif Other DBs NCBI-ProteinID:  ADP77238 UniProt:  E3GY56 LinkDB All DBs Position complement(426819..426974) Genome browser AA seq 51 aa AA seqDB search MAKYKLYEIKGDKIIRKNPFCPRCSSGVFMADHGDRYACGKCGYTKWKRKR NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atggctaaatacaaattatatgaaataaaaggtgacaaaataatacgcaaaaatccattt tgtccacgatgttcaagtggtgtgtttatggcagaccatggtgacagatacgcatgtggt aaatgtggatatactaagtggaaaagaaaaaggtga

DBGET integrated database retrieval system