Methanosarcina flavescens: AOB57_003345 Help Entry AOB57_003345      CDS       T05666                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mfz  Methanosarcina flavescens Pathway mfz03010   Ribosome Brite KEGG Orthology (KO) [BR:mfz00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     AOB57_003345   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     AOB57_003345  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mfz03011]     AOB57_003345    04121 Ubiquitin system [BR:mfz04121]     AOB57_003345   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mfz04147]     AOB57_003345 Ribosome [BR:mfz03011]  Ribosomal proteins   Eukaryotes    Small subunit     AOB57_003345   Archaea     AOB57_003345 Ubiquitin system [BR:mfz04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    AOB57_003345 Exosome [BR:mfz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    AOB57_003345   Exosomal proteins of colorectal cancer cells    AOB57_003345 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_Nudix Ribosomal_L37e Rcat_RNF216 Zn_Ribbon_TF Zn_Ribbon_1 Zn_ribbon_RPB9 DUF1451 Cas12f1-like_TNB Zn_ribbon_NOB1 DUF6671 Zn_ribbon_NUD Zn_ribbon_13 Zn_ribbon_IS1595 Baculo_ME53 Motif Other DBs NCBI-ProteinID:  AYK14354 UniProt:  A0A660HQ25 LinkDB All DBs Position 767241..767390 Genome browser AA seq 49 aa AA seqDB search MAVKDYYKVQGDSVTRVKQFCPRCGPGTFLADHKNRLACGKCGYTEFKK NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggcagtaaaagattactataaagtccagggcgactccgtaaccagagtaaaacagttc tgtcccaggtgcggaccaggtacattcctcgcggaccacaaaaaccgcctcgcctgcgga aaatgcggatataccgaattcaagaaataa

DBGET integrated database retrieval system