KEGG   Mycolicibacterium gadium: MGAD_32150
Entry
MGAD_32150        CDS       T07053                                 
Symbol
hcaE_3
Name
(GenBank) 3-phenylpropionate/cinnamic acid dioxygenase subunit alpha
  KO
K11943  PAH dioxygenase large subunit [EC:1.13.11.-]
Organism
mgad  Mycolicibacterium gadium
Pathway
mgad00624  Polycyclic aromatic hydrocarbon degradation
mgad01100  Metabolic pathways
mgad01120  Microbial metabolism in diverse environments
mgad01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mgad00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    MGAD_32150 (hcaE_3)
Enzymes [BR:mgad01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-
     MGAD_32150 (hcaE_3)
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: BBZ18880
UniProt: A0A7I7WP55
LinkDB
Position
complement(3252402..3253769)
AA seq 455 aa
MTTETTGTADATDPYLRLALRDVADGLKVGRLPARVVSDPALHTIEMERIFGRAWVFLGH
ESELTKSGDFVVRHIGADSVIVCRDSSGRIQALSNSCRHRGALVCRAEMGNTAHFQCPYH
GWVYSNTGELVGVPAMREAYPGGFDKSQWGLRHIPHVDSYAGFIFGSVDPKAPSLTDYLG
DTTFYLDLIAKKTAGGLEVIGAPHRWVMSANWKTAADNFVGDSYHTLFAHRSMVELGMAP
GDPNFASAPAEISLQNGHGVGVLGFPPTLADFPEYEGYPDEVVDQMAASYPSPAHKDMMR
RSAFIHGTVFPNLSFINVTIAPDHMSPPTPFITFRVWHPLSHDRMEILSWFLVERDAPEW
LRDASQASYVNNFGPGGVFEQDDAEAWKAITESVQGPFAGAGLLNYEMGMDLTPLTDWPG
PGEALPSGYAEQNQRRFWGRWLEYMGQPAAFGGRA
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgaccaccgaaacaaccggaacagctgacgcgaccgatccctacctgcggctcgcgttg
cgcgacgtagcggacgggctcaaggtcgggcgcttaccggcccgcgtcgtcagcgatcct
gcgctgcacacgatcgagatggagcggatcttcggacgagcgtgggtgttcctcggacat
gagtcggagttgaccaagtccggcgacttcgtcgtgcggcacatcggggccgattcggtg
atcgtttgccgggacagctccggccggatccaggcgctgtccaattcttgtcgacaccgt
ggtgcgctcgtgtgccgggcggagatgggaaacaccgcgcatttccagtgcccgtaccac
ggctgggtgtacagcaacaccggcgagctcgtcggtgtgccggcgatgagggaggcctat
cccggcggcttcgacaagtcgcagtggggattacgtcacatcccccatgtcgactcgtac
gccggattcatcttcggcagcgtcgatcctaaagcgcccagtctgaccgactacctcggc
gacacgacgttctacctcgacctcattgcgaagaagacggcgggcggtttggaggtgata
ggggcaccgcatcgatgggtgatgtcggcgaactggaagacagccgccgacaattttgtc
ggcgactcctaccacaccctctttgctcaccgctccatggtcgagctgggaatggcgccc
ggtgacccgaacttcgcgagcgcaccagcggagatctcgctgcagaacggccacggcgtc
ggcgtactcggctttccgcccacgctcgccgattttcccgagtacgagggataccccgac
gaagtcgtcgaccagatggcggcgtcctatccgtcgccggcacacaaggacatgatgcga
cgctcggcctttattcacggcaccgtgttcccgaatttgtcgttcatcaacgtgaccatc
gcgccggaccatatgtcgcccccaacccccttcatcacgttccgggtgtggcatccgctc
tctcatgatcggatggagatcctctcctggttcctggtcgaacgcgacgctccggaatgg
ctgcgcgatgcgtcccaggcgtcctacgtcaacaacttcggcccgggcggtgttttcgaa
caggacgacgccgaggcatggaaggccatcaccgaatctgtccagggtccgttcgccggt
gcaggcctgctgaactacgagatgggcatggacttgactccgctcaccgactggccaggg
ccgggagaggctctcccgagcgggtacgcagagcagaaccagcggcggttttgggggaga
tggctggaatacatgggccaacctgccgcattcggtgggcgtgcttga

DBGET integrated database retrieval system