Mycoplasmopsis gallopavonis: NCTC10186_00156 Help Entry NCTC10186_00156   CDS       T07093                                  Symbol MCYN0549 Name (GenBank) Bifunctional protein FolD   KO K01491   methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9] Organism mgal  Mycoplasmopsis gallopavonis Pathway mgal00670   One carbon pool by folate mgal00720   Other carbon fixation pathways mgal01100   Metabolic pathways mgal01120   Microbial metabolism in diverse environments mgal01200   Carbon metabolism mgal01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:mgal00001]  09100 Metabolism   09102 Energy metabolism    00720 Other carbon fixation pathways     NCTC10186_00156 (MCYN0549)   09108 Metabolism of cofactors and vitamins    00670 One carbon pool by folate     NCTC10186_00156 (MCYN0549) Enzymes [BR:mgal01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)      NCTC10186_00156 (MCYN0549)  3. Hydrolases   3.5  Acting on carbon-nitrogen bonds, other than peptide bonds    3.5.4  In cyclic amidines     3.5.4.9  methenyltetrahydrofolate cyclohydrolase      NCTC10186_00156 (MCYN0549) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  THF_DHG_CYH KaiB Motif Other DBs NCBI-ProteinID:  VEU72689 UniProt:  A0A449AYR1 LinkDB All DBs Position 1:219214..219450 Genome browser AA seq 78 aa AA seqDB search MQILSGKELAKKELAQLKQDLIDLELSRQPRLAIIQVGDNPASTKYVEQKRKKCEEVGIE VAVHKFRENISQDRLLKN NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgcaaatattaagtggaaaagaattagctaaaaaagaattagcacaacttaaacaagat ttaattgatcttgaattatctcgtcaaccaagattagcaattattcaagttggtgataat cctgcttcaactaaatatgttgaacaaaaaagaaagaaatgtgaagaagtaggaattgaa gttgctgtgcataaatttagggaaaatatttctcaagatcgtttattaaaaaattag

DBGET integrated database retrieval system