KEGG   Mycobacterium gallinarum: MGALJ_00110
Entry
MGALJ_00110       CDS       T07342                                 
Symbol
hcaE_1
Name
(GenBank) 3-phenylpropionate/cinnamic acid dioxygenase subunit alpha
  KO
K11943  PAH dioxygenase large subunit [EC:1.13.11.-]
Organism
mgau  Mycobacterium gallinarum
Pathway
mgau00624  Polycyclic aromatic hydrocarbon degradation
mgau01100  Metabolic pathways
mgau01120  Microbial metabolism in diverse environments
mgau01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mgau00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    MGALJ_00110 (hcaE_1)
Enzymes [BR:mgau01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-
     MGALJ_00110 (hcaE_1)
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: BBY90342
LinkDB
Position
9709..11076
AA seq 455 aa
MTTETTGTADATDPYLRLALRDVADGLKVGRLPARVVSDPALHTIEMERIFGRAWVFLGH
ESELTKSGDFVVRHIGADSVIVCRDSSGRIQALSNSCRHRGALVCRAEMGNTAHFQCPYH
GWVYSNTGELVGVPAMREAYPGGFDKSQWGLRHIPHVDSYAGFIFGSVDPKAPSLTDYLG
DTTFYLDLIAKKTAGGLEVIGAPHRWVMSANWKTAADNFVGDSYHTLFAHRSMVELGMAP
GDPNFASAPAEISLQNGHGVGVLGFPPTLADFPEYEGYPDEVVDQMAASYPSPAHKDMMR
RSAFIHGTVFPNLSFINVTIAPDHMSPPTPFITFRVWHPLSHDRMEILSWFLVERDAPEW
LRDASQASYVNNFGPGGVFEQDDAEAWKAITESVQGPFAGAGLLNYEMGMDLTPLTDWPG
PGEALPSGYAEQNQRRFWGRWLEYMGQPAAFGGRA
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgaccaccgaaacaaccggaacagctgacgcgaccgatccctacctgcggctcgcgttg
cgcgacgtagcggacgggctcaaggtcgggcgcttaccggcccgcgtcgtcagcgatcct
gcgctgcacacgatcgagatggagcggatcttcggacgagcgtgggtgttcctcggacat
gagtcggagttgaccaagtccggcgacttcgtcgtgcggcacatcggggccgattcggtg
atcgtttgccgggacagctccggccggatccaggcgctgtccaattcttgtcgacaccgt
ggtgcgctcgtgtgccgggcggagatgggaaacaccgcgcatttccagtgcccgtaccac
ggctgggtgtacagcaacaccggcgagctcgtcggtgtgccggcgatgagggaggcctat
cccggcggcttcgacaagtcgcagtggggattacgtcacatcccccatgtcgactcgtac
gccggattcatcttcggcagcgtcgatcctaaagcgcccagtctgaccgactacctcggc
gacacgacgttctacctcgacctcattgcgaagaagacggcgggcggtttggaggtgata
ggggcaccgcatcgatgggtgatgtcggcgaactggaagacagccgccgacaattttgtc
ggcgactcctaccacaccctctttgctcaccgctccatggtcgagctgggaatggcgccc
ggtgacccgaacttcgcgagcgcaccagcggagatctcgctgcagaacggccacggcgtc
ggcgtactcggctttccgcccacgctcgccgattttcccgagtacgagggataccccgac
gaagtcgtcgaccagatggcggcgtcctatccgtcgccggcacacaaggacatgatgcga
cgctcggcctttattcacggcaccgtgttcccgaatttgtcgttcatcaacgtgaccatc
gcgccggaccatatgtcgcccccaacccccttcatcacgttccgggtgtggcatccgctc
tctcatgatcggatggaaatcctctcctggttcctggtcgaacgcgacgctccggaatgg
ctgcgcgatgcgtcccaggcgtcctacgtcaacaacttcggcccgggcggtgttttcgaa
caggacgacgccgaggcatggaaggccatcaccgaatctgtccagggtccgttcgccggt
gcaggcctgctgaactacgagatgggcatggacttgactccgctcaccgactggccaggg
ccgggagaggctctcccgagcgggtacgccgagcagaaccagcggcggttttgggggaga
tggctggaatacatgggccaacctgccgcattcggtgggcgtgcttga

DBGET integrated database retrieval system