Mycobacterium gallinarum: MGALJ_35740
Help
Entry
MGALJ_35740 CDS
T07342
Name
(GenBank) hypothetical protein
KO
K21687
resuscitation-promoting factor RpfA
Organism
mgau
Mycobacterium gallinarum
Brite
KEGG Orthology (KO) [BR:
mgau00001
]
09190 Not Included in Pathway or Brite
09191 Unclassified: metabolism
99986 Glycan metabolism
MGALJ_35740
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Transglycosylas
Motif
Other DBs
NCBI-ProteinID:
BBY93905
UniProt:
A0A9W4BA60
LinkDB
All DBs
Position
3647686..3649170
Genome browser
AA seq
494 aa
AA seq
DB search
MSGRHRKPTASAVNVAKIAFTGAVIGTGGIALAGHANAATDGEWDQVARCESGGNWAINT
GNGYHGGLQFSPSTWSGHGGGEFAPAAYLASKEEQIAVAERVLAGQGKGAWPSCGGPLSG
PTPRNVVDDAIADLNNLLPPPPPNPFAPPPPPPPPAPFDALAAPAPPPPPPGAPLPPPPP
PADALAAPIPPPPPPAAPLPPPPPPADALAAPIPPPPPPAAPLPPPPPADALAAPVPPPP
ADPMAPPPPPPIDALAAPVPPPPVDPMAPPPPAPIDALAAPVPPPPPVDPMAPSTDVAQQ
LADWDVAEGTVPADQPQMWALHADAPLQPAPAVPPPPAPPAPAPGAPVAVAAPAPDPLAQ
VNLPQPAMDAANQAVSGELPVPAEVPHLPSPENLNPGTTIDRGAVTTDSPNVSYLKEIWH
AIQTQDVTGKDALLALTQRPLTTPDRTTGQVPNLPGQLPPDPALAPPPPPAPAPGLPAPA
APPAPGAPPPLPPA
NT seq
1485 nt
NT seq
+upstream
nt +downstream
nt
atgagtggacggcatcgtaagcccactgcatcggccgtaaacgtcgcgaagatcgccttc
acaggcgctgtcatcggcactgggggcattgccctcgccggacacgccaacgccgccacc
gacggcgaatgggatcaggtcgccaggtgcgaatctggtggcaactgggcgatcaatacc
ggcaacggataccacggtggactccagttctccccgagcacctggtcgggccacggcggc
ggcgagtttgcgcctgccgcgtacctggccagcaaggaagagcagattgccgtcgccgag
cgtgtgctcgccggtcagggcaagggcgcatggccgtcgtgcggtggcccgctgtccggc
cccacgccgcgcaatgtggtcgacgacgcgatcgccgacctgaacaacctgctgccgcct
ccgccgccgaacccgttcgctcccccgccgcctcctccgccacccgcgccgttcgacgcg
ctggccgcaccggctcctccgccgccgcctccgggtgcacccctgcccccgccgccaccc
ccggccgacgcgctcgccgccccgattccgccgccaccacccccggccgcaccactgcct
ccgccgccacccccggccgacgcgctcgccgccccgattccgccgccaccacccccggcc
gcaccactgcccccgccacccccggccgacgcgctagccgccccggttccgccaccgccg
gccgacccgatggccccgccgccgccaccaccgatcgacgcgctggccgcaccggtgcct
ccgccgccggtcgacccgatggccccgccgcccccggcaccgatcgacgcgctggccgca
ccggttcctccgccgccgccggtcgacccgatggccccgtctacagacgtcgcgcagcag
ctggcggactgggatgtcgccgagggcaccgtgcctgccgatcagcctcagatgtgggcg
ttgcacgccgacgcaccgcttcagcccgcaccggcagttcctccgccgccggccccgccg
gcacccgcgcccggtgcacccgtcgccgttgcggcacccgcgcccgatccgctggcccag
gtcaaccttccgcagcccgccatggacgcggccaaccaggccgtgtccggtgagctcccc
gtgcccgccgaggttccgcatctgccgagcccggagaacctgaatccggggacgacgatc
gaccgcggcgccgtcacgaccgacagccccaacgtctcctacctcaaggagatctggcac
gcgatccagacccaggacgtcaccggcaaggatgcgctgctggcgctgactcagcgtccg
ttgacaaccccggaccgcaccaccggtcaggtgcccaacctgccgggccagctcccgccg
gatccggcgcttgcgcctccgccgccccctgctccggcaccgggactgcccgcgccggcg
gcacctccggcgcccggtgcgccgccgccgctaccgcctgcctga
DBGET
integrated database retrieval system