Rasiella rasia: G5B37_07275 Help Entry G5B37_07275       CDS       T06461                                  Name (GenBank) co-chaperone GroES   KO K04078   chaperonin GroES Organism mgel  Rasiella rasia Brite KEGG Orthology (KO) [BR:mgel00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mgel03110]     G5B37_07275    03029 Mitochondrial biogenesis [BR:mgel03029]     G5B37_07275 Chaperones and folding catalysts [BR:mgel03110]  Heat shock proteins   HSP10    G5B37_07275 Mitochondrial biogenesis [BR:mgel03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     G5B37_07275 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  QIE59371 UniProt:  A0A6G6GNU1 LinkDB All DBs Position 1614932..1615207 Genome browser AA seq 91 aa AA seqDB search MALKIQPLSDRVVVAPQEAETKTASGLYIPDSAKEKPQQGKVVAVGKGKKDHDMTVKVGD MVLYGKYSGSELKLDGSDYLIMREDDILAIV NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggcattaaaaatccaacccctttcagacagagtagttgttgcgcctcaggaggcagaa acaaaaacggcatctggactatacataccagatagcgctaaagaaaaacctcaacaaggc aaagtagttgccgttggaaaaggtaaaaaagatcacgacatgactgtaaaagtcggtgac atggtgctttatggaaaatattccggtagcgaattaaaactagacggcagcgattaccta atcatgcgtgaagacgatatactcgcaattgtttag

DBGET integrated database retrieval system