Megalopta genalis: 117224307 Help Entry 117224307         CDS       T07400                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism mgen  Megalopta genalis Pathway mgen04013   MAPK signaling pathway - fly mgen04145   Phagosome mgen04148   Efferocytosis mgen04310   Wnt signaling pathway mgen04620   Toll-like receptor signaling pathway mgen05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:mgen00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     117224307    04310 Wnt signaling pathway     117224307  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     117224307    04148 Efferocytosis     117224307  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     117224307  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     117224307  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mgen04131]     117224307   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mgen04147]     117224307    04031 GTP-binding proteins [BR:mgen04031]     117224307 Membrane trafficking [BR:mgen04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     117224307  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     117224307   Macropinocytosis    Ras GTPases     117224307  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     117224307 Exosome [BR:mgen04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    117224307   Exosomal proteins of other body fluids (saliva and urine)    117224307   Exosomal proteins of colorectal cancer cells    117224307   Exosomal proteins of bladder cancer cells    117224307 GTP-binding proteins [BR:mgen04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     117224307 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  117224307 NCBI-ProteinID:  XP_033333014 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPATPIILVGTKLDLR EDKETIERLKDKKLAPITYPQGLTMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPV LQMKPKRRCFLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggccattaagtgcgttgtcgtaggcgacggagccgtaggtaaaacatgccttctc ataagctatactaccaatgcctttcccggggagtatatcccgactgtgtttgacaattat tctgcaaatgttatggtggatggcaaaccgatcaatcttggtttatgggacacagcaggc caagaagattatgacagactaagaccattgtcgtaccctcagacagatgtctttttgatt tgtttttctttggtcaaccctgccagttttgagaatgtacgtgctaaatggtatccagag gtgcgtcatcattgtccagccactccgattatattagtagggactaaattagatttgcgt gaagacaaggaaacaattgaacgattaaaagataagaaattggcaccaatcacatatccc cagggtttgacaatggcaaaagagattggagcagtgaagtatttagagtgttcggctttg actcaaaaaggattgaaaacagtatttgatgaagcaatccgtgctgtattgtgcccagtt ctgcaaatgaaaccaaaacgcagatgtttcctcctataa

DBGET integrated database retrieval system