KEGG   Megalopta genalis: 117227751
Entry
117227751         CDS       T07400                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
mgen  Megalopta genalis
Pathway
mgen00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:mgen00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    117227751
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mgen00199]
    117227751
Enzymes [BR:mgen01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     117227751
Cytochrome P450 [BR:mgen00199]
 Cytochrome P450, animal type
  CYP306 family
   117227751
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 117227751
NCBI-ProteinID: XP_033339147
LinkDB
Position
Unknown
AA seq 507 aa
MNLLVCTIFLASLLLLAYLYDRSRKKVARRLPPGPWQLPIVGYLPWIDAKKPHETLTRLV
RSYGPVCGLRMGSVYTVLLSDPRLIREAFAQDACTGRAPLYLTHGIMQGYGLICAEGNRW
KDQRKFVSRCLRNFGMVKHEGSRRDSLEERISRAADECVSKLGQRSSNGPIDPMDTLHHC
IGNLVNDIVFGKTYPEDDGVWKWLRHLQEEGVKHIGVAGPLNFLPLLRFLPRFGETIRSI
LDGKEKTHEIYRGILEDRRGRGRGRGTNGATSLPTDDENFLAAFDERMSKETTAEDNYYT
EPQLFHLLADLFGAGTDTTLTTLRWFILFLAVHPKEQEKLREEMDRCLNETEYPSLKSRP
SMPRLEAAMAEVQRLRSVTPLGIPHGTLEDTRIGGYDIPKGAMIVPMQWAVHTDPTYWPD
PLEFRPDRFLAEDGSFFKPDSFLPFQSGKRVCVGEELARMTLFLYAGRILRKFDVSIPPD
ETIDLEGDSGITLVPKPHRLMFAERRR
NT seq 1524 nt   +upstreamnt  +downstreamnt
atgaatcttctcgtttgcacgatattcctcgcgtccctcttgcttctggcgtatctgtac
gatagaagccggaagaaggtggcgcgtcgccttcctcccgggccctggcaacttccgatc
gtcggataccttccgtggatcgacgcgaagaaaccgcacgaaactctgaccagactggtc
agaagttacgggcccgtttgcgggcttcgcatgggttccgtctataccgttctcctctcc
gaccctcgtctgatcagggaggccttcgcgcaggacgcgtgtaccggtagagcaccgttg
tatctcacccacggaatcatgcagggatacggcctgatctgcgccgagggcaatcgatgg
aaggaccaaaggaaattcgttagccgttgcttgagaaattttggtatggtgaagcacgaa
ggttcgaggcgcgacagcttggaagaaagaatatcgcgtgccgcggacgaatgcgtatcg
aaactcggtcaacgttcgtcgaacggaccgatcgatcctatggacacgttgcaccattgc
atcggcaatctggtgaacgatatcgtttttggaaagacctaccccgaggacgacggagtt
tggaagtggttgaggcatttgcaagaagaaggagtcaagcatataggcgtcgctggaccg
ttgaacttcctacctctcctcagatttttaccacgattcggcgaaacgatacgatccatc
ctcgatggaaaggagaagactcacgaaatatatcgcggcatactcgaagatcgccgcggc
cgcggccgcggccgcggaaccaacggcgcgacgagtcttcctacggacgacgagaacttt
ttagccgcgttcgacgaacggatgagcaaggagacgacggccgaggataattattacacc
gaaccgcaactcttccatctgctggccgatctctttggcgccggaaccgacacgactttg
acgactctgcgctggttcatcctcttcttggcggtccatccgaaagaacaggagaagctt
cgggaggagatggaccgatgtttgaacgaaacggagtatccgagcttgaagagcagaccc
tcgatgccgcgcctcgaagcagccatggccgaagtgcaaagacttcgcagcgtcaccccg
ttgggtattccgcatggaacgttggaggatactcggatcggcggatacgatatcccgaag
ggcgccatgatcgtgccgatgcaatgggcggttcacaccgatccgacttattggccggat
cctctcgaatttcggccggacagatttctcgcggaggacggcagcttcttcaagccggat
tcgtttctcccctttcaaagcggaaagcgcgtctgcgttggagaagaactcgcgagaatg
acattgtttctctacgctggaaggattctccgaaagttcgacgtgtccataccgccggac
gaaaccatcgatctcgagggcgactctggtatcacgctggttccgaagcctcaccgactg
atgttcgccgaaagacgtcgataa

DBGET integrated database retrieval system