Micropruina glycogenica: MPLG2_1294 Help Entry MPLG2_1294        CDS       T05338                                  Symbol acpA Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mgg  Micropruina glycogenica Pathway mgg00998   Biosynthesis of various antibiotics mgg01100   Metabolic pathways mgg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mgg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MPLG2_1294 (acpA)    00074 Mycolic acid biosynthesis     MPLG2_1294 (acpA)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MPLG2_1294 (acpA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  SPD86330 UniProt:  A0A2N9JFI2 LinkDB All DBs Position 1:1285803..1286045 Genome browser AA seq 80 aa AA seqDB search MATTEEIRAQLAELVNDVAGTPVEDVQLDKSFVDDLDVDSLAMVEIIVGCEEKFGVTIPD EESKNLKTVGDAVAYIEAHS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggccaccaccgaagagatccgcgctcagctggctgagctcgtcaacgatgtcgccggt acgccggtcgaggacgtccaactggacaagtccttcgtcgatgacctcgacgtcgactcg ctcgcgatggtcgagatcatcgtcggctgcgaagagaagttcggcgtgacgattcccgac gaggagtcgaagaacctcaagaccgtcggcgacgccgtggcctacatcgaggcgcacagc tga

DBGET integrated database retrieval system