Micropruina glycogenica: MPLG2_1726 Help Entry MPLG2_1726        CDS       T05338                                  Name (GenBank) protein of unknown function   KO K03116   sec-independent protein translocase protein TatA Organism mgg  Micropruina glycogenica Pathway mgg03060   Protein export mgg03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:mgg00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     MPLG2_1726  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     MPLG2_1726  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:mgg02044]     MPLG2_1726 Secretion system [BR:mgg02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    MPLG2_1726 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E DUF5326 Motif Other DBs NCBI-ProteinID:  SPD86762 UniProt:  A0A2N9JF46 LinkDB All DBs Position 1:complement(1697884..1698138) Genome browser AA seq 84 aa AA seqDB search MFGLPGGMEWVILAIIALLVFGGSRLASAGKNAGKAIREFKEETSSLKKTDPPAVEAPPA QPEPEGIVHEGEIVPEPKDKGQQA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgttcggcctgcccgggggcatggaatgggtcatcctcgccatcatcgccctactcgtc ttcggcggcagccggctggccagtgccggcaagaacgccggcaaggcgatccgcgagttc aaagaagaaacgtcgtcgttgaagaagaccgacccgcccgctgtcgaggcgcctccggct cagcctgagcctgagggcatcgtgcacgagggcgagatcgtccccgagccgaaggacaag ggccagcaggcctga

DBGET integrated database retrieval system