Malassezia globosa: MGL_1603 Help Entry MGL_1603          CDS       T01043                                  Name (RefSeq) hypothetical protein   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism mgl  Malassezia globosa Brite KEGG Orthology (KO) [BR:mgl00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mgl01009]     MGL_1603 Protein phosphatases and associated proteins [BR:mgl01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      MGL_1603 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 EF-hand_FSTL1 EH AIF-1 Motif Other DBs NCBI-GeneID:  5855727 NCBI-ProteinID:  XP_001731420 UniProt:  A8PY70 LinkDB All DBs AA seq 70 aa AA seqDB search MVGGNLKDQQLQQIVDKTIMEADKNGDGKIDFYEFLDMVNNTDVAKQLTLGVRIRQRIKP FILTHVQDLF NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atggtgggtggcaatttgaaagatcaacagctgcagcaaatcgtcgataagacgattatg gaggcggataagaatggcgatggaaaaattgacttttacgagttcctcgacatggttaac aatacggacgtggcaaagcagctgacgttaggtgtacgtatacggcagcgaattaaaccg tttattctcacacatgtacaggacttgttttaa

DBGET integrated database retrieval system