Malassezia globosa: MGL_2618 Help Entry MGL_2618          CDS       T01043                                  Name (RefSeq) hypothetical protein   KO K02183   calmodulin Organism mgl  Malassezia globosa Pathway mgl04070   Phosphatidylinositol signaling system Brite KEGG Orthology (KO) [BR:mgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     MGL_2618  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mgl01009]     MGL_2618   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mgl04131]     MGL_2618    03036 Chromosome and associated proteins [BR:mgl03036]     MGL_2618   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mgl04147]     MGL_2618 Protein phosphatases and associated proteins [BR:mgl01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      MGL_2618 Membrane trafficking [BR:mgl04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     MGL_2618 Chromosome and associated proteins [BR:mgl03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      MGL_2618 Exosome [BR:mgl04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    MGL_2618 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 AIF-1 UPF0154 EFhand_Ca_insen SPEF2_C Poly_export Dockerin_1 PA_Ig-like TerB FCaBP_EF-hand EH DUF6240 Motif Other DBs NCBI-GeneID:  5854541 NCBI-ProteinID:  XP_001730236 UniProt:  A8Q4R7 LinkDB All DBs AA seq 112 aa AA seqDB search MACLRCIDGDGSITTKELGTVMRSLGQNPTEAELQDMVNEIDADGDGTIDFPEFLTMMAR KMKDTDSEEEIKEAFRVFDKDGNGFISAAELRHVYVWGHSNVIDFKVHCVQD NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggcatgcttacggtgtatagacggggatggaagcatcacaacgaaagaactaggcact gtgatgcgttcactgggtcaaaacccaactgaggcagaattgcaagacatggtgaatgaa attgatgctgatggcgacggcaccattgactttcctgagtttctcacgatgatggctcgc aagatgaaggacacagatagtgaagaggaaatcaaggaggcttttcgcgtatttgacaag gatggtaatggcttcatcagtgcagcagagctgcgtcatgtgtacgtatggggacacagc aatgtgatcgatttcaaggttcactgtgtgcaagactaa

DBGET integrated database retrieval system