Malassezia globosa: MGL_3108 Help Entry MGL_3108          CDS       T01043                                  Name (RefSeq) hypothetical protein   KO K13113   ubiquitin-like protein 5 Organism mgl  Malassezia globosa Brite KEGG Orthology (KO) [BR:mgl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:mgl03041]     MGL_3108   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mgl04052]     MGL_3108 Spliceosome [BR:mgl03041]  Complex B   Other components    Complex B specific factors     MGL_3108 Cytokines and neuropeptides [BR:mgl04052]  Neuropeptides   Unclassified    MGL_3108 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 OTU1_UBXL Crinkler UN_NPL4 YukD Motif Other DBs NCBI-GeneID:  5853870 NCBI-ProteinID:  XP_001729564 UniProt:  A8Q7S8 LinkDB All DBs AA seq 68 aa AA seqDB search MRMIEVIANDRLGRKVRVKCSPEDTVGDLKKLIAAQTGTAPHKSYSTFKDHITLADYEIH DGDSLELH NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgcgcatgattgaagtaatagcaaatgaccgcttgggacggaaagtacgtgtcaagtgc agtcccgaagacacagtgggtgatctgaagaaactgattgcggcccagactggtaccgcc ccgcataaatcgtactcgacgtttaaagatcatattacactggccgactatgaaattcat gacggcgattcattagagctgcattga

DBGET integrated database retrieval system