Malassezia globosa: MGL_3235 Help Entry MGL_3235          CDS       T01043                                  Name (RefSeq) hypothetical protein   KO K12623   U6 snRNA-associated Sm-like protein LSm4 Organism mgl  Malassezia globosa Pathway mgl03018   RNA degradation mgl03040   Spliceosome Brite KEGG Orthology (KO) [BR:mgl00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     MGL_3235   09123 Folding, sorting and degradation    03018 RNA degradation     MGL_3235  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mgl03019]     MGL_3235    03041 Spliceosome [BR:mgl03041]     MGL_3235 Messenger RNA biogenesis [BR:mgl03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      MGL_3235   mRNA degradation factors    5'-3' decay     Lsm complex      MGL_3235 Spliceosome [BR:mgl03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     MGL_3235 SSDB OrthologParalogGFIT Motif Pfam:  LSM Motif Other DBs NCBI-GeneID:  5853997 NCBI-ProteinID:  XP_001729691 UniProt:  A8Q8A5 LinkDB All DBs AA seq 86 aa AA seqDB search MLPLTLLNAAHDGPILVELKNSETFNGHLVACDNYMNITMRDVFQTSSSGEQFWKMPEVY IKGSTVCTLFRAHECPRSSIVVWHMN NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgctaccactgacgttgctcaatgcagcacacgatggcccaatcctggtcgagctgaaa aatagcgagactttcaacggccacctggtcgcttgcgacaactatatgaacattacgatg cgcgacgtgttccaaacaagctcaagcggcgagcaattttggaaaatgccagaggtgtat atcaaagggagcacggtatgtacgttgtttcgcgctcatgagtgtcccagatcaagtatt gtcgtgtggcacatgaactga

DBGET integrated database retrieval system