Malassezia globosa: MGL_3474 Help Entry MGL_3474          CDS       T01043                                  Name (RefSeq) hypothetical protein   KO K03094   S-phase kinase-associated protein 1 Organism mgl  Malassezia globosa Pathway mgl03083   Polycomb repressive complex mgl04111   Cell cycle - yeast mgl04120   Ubiquitin mediated proteolysis mgl04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mgl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     MGL_3474    04120 Ubiquitin mediated proteolysis     MGL_3474   09126 Chromosome    03083 Polycomb repressive complex     MGL_3474  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     MGL_3474  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mgl04131]     MGL_3474    04121 Ubiquitin system [BR:mgl04121]     MGL_3474    03036 Chromosome and associated proteins [BR:mgl03036]     MGL_3474 Membrane trafficking [BR:mgl04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     MGL_3474 Ubiquitin system [BR:mgl04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      MGL_3474    Cul7 complex      MGL_3474 Chromosome and associated proteins [BR:mgl03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      MGL_3474   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      MGL_3474 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ BTB Motif Other DBs NCBI-GeneID:  5853746 NCBI-ProteinID:  XP_001729439 UniProt:  A8Q9F9 LinkDB All DBs AA seq 120 aa AA seqDB search MVLLTTSDNEHFTVDRDVAERSVLIKQMIEDIGETDQPIPLPNVSSSVLTKVLEYCSHHR HDPPVPADDTDEMRRRATDISEWDAKFIQVDQEMLFEIILAANYLDIKSLLDIGCKTVYV NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggtgctgcttacgacgtcggacaatgagcatttcaccgtggatcgcgatgtggcagag cggtctgttttgatcaagcagatgatcgaagacattggcgagacagaccagcctattcca ttgcccaatgttagctccagtgtacttaccaaagtgcttgaatactgcagtcaccaccgg cacgatccacctgtgcccgctgatgacactgacgaaatgcgtcgtcgcgccacagacata tccgaatgggatgccaagtttattcaggttgaccaggaaatgctgttcgaaatcatttta gcggccaactatctcgatatcaagagccttctcgatatcgggtgcaagacagtgtacgta tga

DBGET integrated database retrieval system