Malassezia globosa: MGL_3754 Help Entry MGL_3754          CDS       T01043                                  Name (RefSeq) hypothetical protein   KO K04513   Ras homolog gene family, member A Organism mgl  Malassezia globosa Pathway mgl04011   MAPK signaling pathway - yeast mgl04081   Hormone signaling mgl04144   Endocytosis mgl05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:mgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     MGL_3754   09133 Signaling molecules and interaction    04081 Hormone signaling     MGL_3754  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     MGL_3754  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     MGL_3754  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mgl04131]     MGL_3754   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mgl04147]     MGL_3754    04031 GTP-binding proteins [BR:mgl04031]     MGL_3754 Membrane trafficking [BR:mgl04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     MGL_3754 Exosome [BR:mgl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MGL_3754   Exosomal proteins of other body fluids (saliva and urine)    MGL_3754   Exosomal proteins of colorectal cancer cells    MGL_3754   Exosomal proteins of bladder cancer cells    MGL_3754 GTP-binding proteins [BR:mgl04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     MGL_3754 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Motif Other DBs NCBI-GeneID:  5853593 NCBI-ProteinID:  XP_001729287 UniProt:  A8QAJ5 LinkDB All DBs AA seq 196 aa AA seqDB search MTELRRKLVIVGDGACGKTCLLIVFSKGTFPEVYVPTVFENYVADVEVDGRHVELALWDT AGQEDYDRLRPLSYPDSHVILICFAIDSPDSLDNVQEKWISEVLHFCQNLPIILVGCKKD LRRDPKIIEELRKTSQRPVTPEEGMAVASKIGAVRYLECSAKTGEGVREVFEHATRAALI QKPRGSRSGKSKCLVL NT seq 591 nt NT seq  +upstreamnt  +downstreamnt atgactgaactccgtcggaagttggtaatcgtcggtgatggtgcctgtggaaagacttgt cttctgattgtttttagcaagggaaccttccccgaggtttatgttccaacagtgttcgag aactatgtggccgacgttgaggtagacggccgccatgttgaactggctctttgggatacg gctggtcaggaggattatgatcgtcttcgtccactctcgtacccagactctcatgtgatt ctgatttgcttcgccatcgactctccggacagtcttgataacgtccaggaaaagtggatc tctgaagttctacacttttgccaaaacttgccgatcattctagtgggctgtaagaaggat cttcgtcgcgacccgaaaatcatcgaggagcttcgcaagaccagtcagcgtcctgtcaca ccagaggaaggtatggcagtggcttctaagattggtgctgtgcgctacctagagtgcagc gccaagacgggcgagggtgtgcgggaagtcttcgagcatgccactcgtgctgcactcata cagaagccgcgcggcagccggagcggcaagtctaagtgccttgtgctctaa

DBGET integrated database retrieval system