Myxine glutinosa (Atlantic hagfish): 137437572 Help Entry 137437572         CDS       T12065                                  Symbol LOC137437572 Name (RefSeq) neo-calmodulin   KO K02183   calmodulin Organism mglt  Myxine glutinosa (Atlantic hagfish) Pathway mglt04020   Calcium signaling pathway mglt04070   Phosphatidylinositol signaling system mglt04114   Oocyte meiosis mglt04218   Cellular senescence mglt04261   Adrenergic signaling in cardiomyocytes mglt04270   Vascular smooth muscle contraction mglt04371   Apelin signaling pathway mglt04625   C-type lectin receptor signaling pathway mglt04744   Phototransduction mglt04910   Insulin signaling pathway mglt04912   GnRH signaling pathway mglt04916   Melanogenesis Brite KEGG Orthology (KO) [BR:mglt00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     137437572 (LOC137437572)    04020 Calcium signaling pathway     137437572 (LOC137437572)    04070 Phosphatidylinositol signaling system     137437572 (LOC137437572)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     137437572 (LOC137437572)    04218 Cellular senescence     137437572 (LOC137437572)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     137437572 (LOC137437572)   09152 Endocrine system    04910 Insulin signaling pathway     137437572 (LOC137437572)    04912 GnRH signaling pathway     137437572 (LOC137437572)    04916 Melanogenesis     137437572 (LOC137437572)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     137437572 (LOC137437572)    04270 Vascular smooth muscle contraction     137437572 (LOC137437572)   09157 Sensory system    04744 Phototransduction     137437572 (LOC137437572)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mglt01009]     137437572 (LOC137437572)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mglt04131]     137437572 (LOC137437572)    03036 Chromosome and associated proteins [BR:mglt03036]     137437572 (LOC137437572)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mglt04147]     137437572 (LOC137437572) Protein phosphatases and associated proteins [BR:mglt01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      137437572 (LOC137437572) Membrane trafficking [BR:mglt04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     137437572 (LOC137437572) Chromosome and associated proteins [BR:mglt03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      137437572 (LOC137437572) Exosome [BR:mglt04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    137437572 (LOC137437572) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 CFAP251_C EF-hand_FSTL1 Allatotropin-like_C EH EF_EFCAB10_C SPARC_Ca_bdg EF_SSP120 Dockerin_1 SAPC2_N UPF0154 EF-hand_11 Caleosin BamM_C TerB EFhand_Ca_insen FCaBP_EF-hand EF-hand_EFHB_C DUF1103 SPEF2_C DUF5580_M EF-hand_STIM1 PA_Ig-like Motif Other DBs NCBI-GeneID:  137437572 NCBI-ProteinID:  XP_067988107 LinkDB All DBs Position 12:complement(86846263..86875552) Genome browser AA seq 149 aa AA seqDB search MADHLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLTMMARKMKDADGEEEVREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE EVGEMIREADIDGDGQVNYEEFIKMIMLK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggctgatcatcttacagaggagcaaattgcagaattcaaggaagcattctcactcttt gataaggatggtgatggtacaatcaccacaaaggagttggggacagtcatgcggtctctt ggccaaaaccccacagaggcagaactgcaggacatgattaatgaagttgatgctgatggc aatggaacaattgattttcccgagtttctcacgatgatggcacgaaaaatgaaggatgcg gatggtgaagaggaagtcagggaagcctttagggtttttgacaaggatgggaatggtttt atcagtgcagcagagctgcggcatgtaatgacaaatcttggtgagaaattaaccgacgag gaagtgggtgagatgatccgggaagcagacatcgacggagatggtcaagtcaattatgaa gagttcataaaaatgattatgctgaaatga

DBGET integrated database retrieval system