Mucilaginibacter gossypii: DIU38_025985 Help Entry DIU38_025985      CDS       T06453                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mgos  Mucilaginibacter gossypii Pathway mgos01100   Metabolic pathways mgos01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mgos00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DIU38_025985    00074 Mycolic acid biosynthesis     DIU38_025985   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DIU38_025985 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QEM19323 LinkDB All DBs Position 6080896..6081153 Genome browser AA seq 85 aa AA seqDB search MQIEEIIEKINSFLAEEFEVDADKMVPTANLKETLDLDSLDYIDLVVVIESNFGFKVKPE DFTGIVTFQDFYDYVLSRVQPKELA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaaattgaagagatcatagaaaaaatcaacagcttccttgccgaagaatttgaggtt gatgcagataaaatggtgcccacagcaaatctgaaagaaaccctcgaccttgacagtctt gattatatagaccttgttgtagtaattgaaagcaactttgggttcaaagtaaaacctgag gattttacgggtattgttaccttccaggatttttacgattacgtactatcacgcgtacaa cctaaggagcttgcataa

DBGET integrated database retrieval system