Meleagris gallopavo (turkey): 100540028 Help Entry 100540028         CDS       T01523                                  Symbol CLDN11 Name (RefSeq) claudin-11   KO K06087   claudin Organism mgp  Meleagris gallopavo (turkey) Pathway mgp03272   Virion - Hepatitis viruses mgp04382   Cornified envelope formation mgp04514   Cell adhesion molecule (CAM) interaction mgp04530   Tight junction Brite KEGG Orthology (KO) [BR:mgp00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     100540028 (CLDN11)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     100540028 (CLDN11)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     100540028 (CLDN11)  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     100540028 (CLDN11)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mgp03037]     100540028 (CLDN11)    04147 Exosome [BR:mgp04147]     100540028 (CLDN11) Cilium and associated proteins [BR:mgp03037]  Other cilia and associated proteins   Stereociliary proteins    100540028 (CLDN11) Exosome [BR:mgp04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    100540028 (CLDN11)   Exosomal proteins of colorectal cancer cells    100540028 (CLDN11) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 zf-LITAF-like Motif Other DBs NCBI-GeneID:  100540028 NCBI-ProteinID:  XP_010715387 LinkDB All DBs Position 11:complement(19489560..19497629) Genome browser AA seq 164 aa AA seqDB search MDELGSKGLWADCVMATGLYHCKPLVDILILPGYVQACRALMIAASVLGLPAIFLLITVL PCIRMGHEPGAAKYRRSQLGGILIILLAMCGVVATIWFPVCAHRETTIMSFGYSLYTGWI GSALCLFGGCVIVCCSGDAQTFGENRFYYASGSSSPTHAKSAHV NT seq 495 nt NT seq  +upstreamnt  +downstreamnt atggacgagctgggctccaaggggctgtgggcagactgcgtcatggcgacgggcctctac cactgcaagccgctggtggacatcctcatcctgccaggctacgtccaggcgtgccgagcg ctgatgatcgccgcctccgtgctgggcctccccgccatcttcctgctcatcaccgtgctg ccctgcatccggatgggccacgagcccggcgccgccaagtaccgccgctcccagctgggg gggatcctcatcatcctcctggccatgtgcggcgtggtagccaccatctggttccccgtc tgcgcccaccgtgaaaccaccatcatgagctttggatactccctgtacacgggctggatc ggctctgccctctgcctctttggtggctgcgtcatcgtctgctgctcgggggatgctcag accttcggcgagaatcgcttctactacgcctcgggctccagctcccccacccacgctaag agtgcccacgtctga

DBGET integrated database retrieval system