KEGG   Meleagris gallopavo (turkey): 100541959
Entry
100541959         CDS       T01523                                 

Gene name
MSH6
Definition
(RefSeq) DNA mismatch repair protein Msh6
  KO
K08737  DNA mismatch repair protein MSH6
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    100541959 (MSH6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100541959 (MSH6)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     100541959 (MSH6)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I MutS_IV PWWP MutS_II
Other DBs
NCBI-GeneID: 100541959
NCBI-ProteinID: XP_010704786
Ensembl: ENSMGAG00000005109
LinkDB
Position
2
AA seq 1262 aa
MEGYPWWPCLIYNHPTEGTIVRGKGSSARIHVQFFDVSPTRGWVSIKYLRPYKGSSDREV
LKGGMFYSTKPEIKKAMELADDAMNKDKPKRLELAVCSEPSDAEEAEEEEMEMSGSASGD
SDDSNSEEDVKGKKRVPSRGSAIKAKRRRVLDSDSDRDGSDVEFKPDVKEAASSEEASSG
VDENEATDAETDAESVEESPIKVPSKRKRGNVSKPSKRSSLENEHSEAPKRAAPVSLEAK
SKLTLFAAPDNFESQANACSGGTGGLAAWEHEKLEWLQEGKKKDAHRRRQNDPDYDPCTL
YVPEDYLNKCTPGMRRWWQLKSQNFDAVICYKVGKFYELYHMDAVIGVNELGLIFMKGSW
AHSGFPETAFGRFSAILVQKGYKIARVEQTETPEMMEARCKATAHPTRFDKVVRREICRI
LTKGTQTYSIIDCDPSENHNKYLLCVKEKEDSSGQRVYGVCFVDTSVGKFYVGQFSDDRH
CSRFRTLVAHYTPVQVLFEKGNLTVDTQKILKGSLISCIQEGLISGSQFWSASKTLKVLL
EEEYFKENQNPENGCVLPSVIKSLTSESDSLGLTPGENSELALSALGGIVFYLKKCLIDQ
ELLSLANFEKYVPVDADNAKTASASNFFARTDRRMVLDGVTLMNLEVLQNGTNGTTEGTL
LERIDSCCTPFGKRLLKQWLCAPLCNPTSINDRLDAVEDLLAVPAKLTEISEHLKKLPDL
ERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMNEIVDAMEEV
ASDFKSQVLKQLVTRKAKHPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKAGFDSDYD
KALQDIKTVEEDFRAYLDKQRKLLGVKSVLYWGTGKNRYQMEIPETAISRNLPEEYELKS
TRKGYKRYWTKEIEKMLAELINAEERRDAALKDCMRRLFYNFDKNSQDWQTAVQCIAVLD
VLMSLANYSQDGDGPLCRPVILLPVDSAPPVLELKNARHPCITKTFFGDDFIPNDIVIGS
KDEDGGSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCRLTPIDRVFTRLG
ASDRIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVRELAEN
IKCRTLFSTHYHSLVEDYSGSAAVRLGHMACMVENESEDPSQETITFLYKFIEGACPKSY
GFNAARLADIPEEVIQKGHRKAREFEEKTMSLRIFRFLCRVVDGATRDANAVGKLSTMLS
HL
NT seq 3789 nt   +upstreamnt  +downstreamnt
atggaaggctatccctggtggccgtgcctcatctacaaccaccccacagaaggaaccatc
gtcagagggaaggggagctctgctcggatccacgtgcagttctttgatgtcagtcccacg
aggggctgggtcagcatcaagtacctgaggccatacaaaggctcatcagacagagaggtg
ctgaagggaggtatgttttatagtacgaagcctgaaattaaaaaagcaatggagctggca
gatgatgccatgaataaagataaacctaagagacttgagctggcagtgtgcagcgaacct
tcagatgctgaggaggcagaggaggaggaaatggagatgagtggaagtgcatcaggtgac
agtgatgacagcaatagtgaggaggatgtgaagggcaagaagcgagtaccaagcagagga
agtgccataaaagccaaaagaagaagagtgctggattcggacagcgatcgtgatggttct
gatgtagagttcaagcctgatgtgaaagaagcagcaagcagcgaggaagctagtagtggg
gtggatgaaaatgaagctactgatgcagagacagatgcagagagcgttgaagaaagtccc
ataaaagtcccttctaaacggaagagaggaaacgttagcaagccttctaaaagaagtagc
ttggaaaatgaacattctgaagcacccaaaagagccgcaccagtttcgttagaagccaag
tctaagctgacattgtttgcagcacctgacaattttgagtctcaggcaaatgcttgcagt
ggaggcactggtggcttggcagcatgggaacatgagaagcttgagtggctgcaggaaggg
aaaaagaaagatgcacacaggagacgacagaatgaccctgactatgacccatgtactttg
tacgtacctgaggactatcttaacaaatgtacacctggaatgcggaggtggtggcagctg
aaaagtcagaactttgatgcggtgatttgctacaaagttggaaaattctatgagttgtat
cacatggatgcagtcattggtgtgaatgagctgggcctgatatttatgaaaggttcatgg
gctcattccggttttccagaaactgcatttggcagattctctgctattctggttcagaag
ggctacaagatagcccgtgttgagcaaacagaaactcctgaaatgatggaagcgcgctgc
aaggcaacggcccacccaaccaggtttgacaaggttgtacgtcgggaaatctgcagaatc
cttaccaagggcactcagacttacagcattatagattgtgatccgtcagagaaccataac
aaataccttctgtgtgttaaggaaaaagaagactcctctggacaacgtgtttatggggtc
tgttttgttgacacatcagttgggaagttttatgttggccagttctcagatgaccggcac
tgctcgaggtttaggactttagtggcacattacactcctgtgcaggtcctgtttgagaag
gggaacctgactgtggacactcagaagatactgaaaggctcactcatttcttgcattcag
gaggggctgatctctggctcccagttctggagtgcatctaaaacactaaaagttcttctt
gaagaagagtatttcaaggagaatcaaaaccctgagaatggatgtgttctgccctctgta
atcaaatctctgacttcagagagtgactcgctggggttaactcctggcgaaaacagcgag
ttagctttgtcagctcttgggggaattgtcttctatctcaaaaagtgtctgattgatcag
gagctgctatcgctggcaaactttgagaagtatgtccctgtggatgctgataatgcaaaa
actgcaagtgccagtaatttctttgccagaactgaccggcgcatggtgctggacggagtc
actctgatgaatctggaagtcctgcagaatggaaccaacggaaccacagaaggtactttg
ttggagaggattgattcctgttgtacgccgtttgggaagcggctcctgaaacagtggctt
tgtgctccgctttgtaatcctacatccattaatgatcgtttagatgctgttgaggacctt
ctggcggtgccggctaaactgactgaaattagtgagcatctgaagaaacttcctgacctt
gaaaggctgctcagcaaaattcacagcattggatcaccgcttaaaagtcagaaccatcct
gacagcagggccatcttttatgaagaaattaaatacagcaaaaaaaaaattgccgacttt
ttgtctgcgctggaggggtttaaagtaatgaacgaaattgtcgatgccatggaagaagtt
gccagtgacttcaaatctcaagtccttaagcagttggtcacccgcaaagccaaacatcca
gatggacgcttcccagacttgagcgcagagcttaaaaggtgggatactgcttttgatcat
aaccaggctcgcaagacaggagtgattactccaaaggcaggttttgactccgattacgat
aaagcactacaggatattaaaactgttgaggaagatttccgagcatacctcgataagcaa
cgcaaactgctcggagtcaaatccgtgctgtactgggggacgggcaaaaatcggtatcaa
atggaaataccagaaaccgccatatcgcgtaatttacctgaagaatacgagctgaagtca
accaggaaaggatacaaacgttactggaccaaggagattgagaagatgctggctgagttg
attaatgctgaggagcgaagagatgcggctctgaaagactgcatgaggcgtttgttttac
aactttgacaaaaacagccaagactggcagacagccgtacagtgcatcgctgtgctggat
gtcttgatgtcccttgctaactacagtcaagatggtgatggaccactgtgccgacctgta
attctactgcctgtggatagtgctcctcccgtcctggaactgaaaaatgcacgccatcct
tgcattacaaaaactttctttggggatgattttattcctaatgacatcgtgataggcagt
aaggatgaagatggtggtagtgaagcttcctgtgtactagtcactggcccaaacatgggt
ggcaaatcaacactcatgagacaggctggtctcctggttataatggctcagctgggatgc
tacgtgcctgctgaggtctgcaggctcacacccatcgaccgagtatttacacggctcggt
gcctccgacagaatcatgtcaggtgaaagtaccttctttgttgaattaagcgagacttcc
agcatcctgcagcatgcaacagagcattccctcgttcttgtggatgaactcggccgaggc
acggctacgtttgatggaacagcgatagcaagtgcagttgttagagaacttgccgagaac
atcaagtgtcgcacgctgttctccacgcattaccactccttggtagaggactactcgggc
agcgcggccgtgcggctcggacacatggcttgtatggtggaaaatgagagcgaagatcca
agccaagaaacaattacatttctgtataaattcattgaaggagcgtgtccaaaaagctat
ggcttcaatgcagcaagacttgctgacatcccagaggaagttattcagaaagggcacaga
aaagcaagagagtttgaagaaaagacaatgtcactgcgaatattcaggtttctgtgccgg
gtggtggatggtgcaacacgtgatgcgaacgcggtagggaagcttagcactatgctcagt
cacctttaa

DBGET integrated database retrieval system