KEGG   Meleagris gallopavo (turkey): 100542264
Entry
100542264         CDS       T01523                                 

Gene name
MSH2
Definition
(RefSeq) DNA mismatch repair protein Msh2
  KO
K08735  DNA mismatch repair protein MSH2
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    100542264 (MSH2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100542264 (MSH2)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     100542264 (MSH2)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_II MutS_IV MutS_I AAA_27 ArdA
Other DBs
NCBI-GeneID: 100542264
NCBI-ProteinID: XP_010704792
Ensembl: ENSMGAG00000005134
LinkDB
Position
2
AA seq 884 aa
MMNTLKHLTSPLSPPSTFLSIGNQKLESVVLSKMNFESFVRDLLLVRHYRVEVYKNKAGS
KSVKENDWYLAYKGSPGNLAQFEEVLFANNDMSMAIGVVGVKLSSADGQRVIGVGYVDTT
LRKLSVCEFPDNDQFSNLEALLVQLGPKECVLPGGDTAGEMGKLRQVIQRGGILITDRKK
ADFTTKDIVQDLNRLLKSRKGEQMNSAALPEMEKQVAVSSLSAVIKFLELLSDDSNFGQF
ELTTFDLSQYMVLDNAAVQALNLFQSSVENANNTQSLAGLLNKCRTPQGQRLVNQWIKQP
LMDKNRIEERLNLVEAFVEDTELRQGLQEDLLRRFPDLNRLAKRFQRQAATLQDCYRMYQ
AINQLPNVVQALEKHEGAHQMLLLAVFITPLNDIHSDFSKFLEMIETTLDMDKVENHEFL
VKASFDPNLTELREKMNELEENMQTLLKSAAKELGLEAGKSIKLESNSQFGHHFRITCKE
EKVLRNNSKYKITDTQKNGVKFTNSKLSAINEDYIKNREEYEEAQDAIVKEIINIASGYA
EPIQTMNDVIAQLDAIVSFAHVSNGAPVPYVRPVVLEKGQGRIVLKGARHPCIEVQDEVA
FIPNDVTFEKGKQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCDSAEITIVDCIL
ARVGAGDSQLKGVSTFMAEMLETASILRTASENSLIIIDELGRGTSTYDGFGLAWAISEY
IASKICAFCMFATHFHELTALADQVPTVNNLHVTALTSDDTLTMLYRVKAGVCDQSFGIH
VAELAAFPKHVIENAREKALELEEFQDLGRPKESEGEPAAKKCYREREEGEKIIQDFLCQ
VKALPLTDMSEEDIKTKLKQLRADVLAKNNSFVNEIISRTKVTP
NT seq 2655 nt   +upstreamnt  +downstreamnt
atgatgaacacactgaagcatcttacaagtcccctctcccctccctctacttttctttcc
ataggaaatcagaaactggagagcgttgtgctcagtaaaatgaactttgaatcttttgtg
agagatttgctgctggttcgtcattacagagtggaagtttacaagaataaagcagggagt
aaatctgtcaaagagaacgactggtatttagcatacaagggttctccgggaaatcttgcc
cagtttgaggaagttctctttgccaacaatgatatgtcaatggccatcggggttgtgggg
gtgaagctgtcttctgctgatggacaaagagtaataggagtagggtatgtggacactacg
ctgagaaaactgagcgtctgtgagttcccagataacgatcagttctcaaaccttgaagcc
ctgctggttcagctaggacccaaggagtgtgtgctgccaggaggagacactgcaggagag
atggggaaactgcggcaggtcattcagagaggaggaatcctgattacagacagaaagaag
gcagatttcacgacaaaggatattgttcaggatctcaatcgcttgttaaaatcgagaaaa
ggagaacaaatgaatagtgcagcattgccagagatggaaaagcaggttgctgtttcatct
ttgtcagccgttatcaagtttttggagttgctgtcagatgactctaactttggacaattt
gaactgactacttttgatcttagtcagtatatggttctagacaatgcagctgtccaagcc
ctcaacctgttccagagttctgtggaaaatgctaataatacacagtctctggctggttta
ctaaataaatgcagaacccctcaaggacaaagactggttaatcagtggatcaaacagccg
cttatggacaagaatagaattgaagaaaggttgaatttggttgaagcctttgtggaagat
actgaactgcgtcagggccttcaagaagatcttctgcgccgcttcccagatcttaatcgg
ctagcaaagagatttcagaggcaagcagcaaccttacaggactgttaccgaatgtatcaa
gctattaaccaactgcctaatgttgtacaggcactagaaaaacacgaaggagctcaccag
atgttgttattggcagtgtttataacacctcttaatgatatccactccgacttctcaaaa
tttctggagatgatagaaacaacattggatatggataaggtggagaatcatgagttcctt
gttaaggcttcttttgaccccaacctgacagaactgcgagagaagatgaatgagctggaa
gaaaacatgcagaccttattaaagagtgcagccaaagagcttggtttggaagctggtaaa
agtatcaaattggagtcaaattcacagtttggacaccactttcgaattacttgcaaggag
gaaaaggttcttaggaacaattcaaagtacaagataactgatacacagaagaatggtgtg
aaatttacaaacagcaagctgagtgccatcaatgaggattacataaagaacagagaagag
tacgaagaggctcaggatgcaattgttaaggaaattattaacatcgcttcaggttatgca
gagccaatacagaccatgaatgatgtaatagctcagttagatgcaattgtcagttttgct
cacgtgtcaaacggagcgccagtgccgtatgtccgtcctgtcgttctggaaaaggggcaa
ggaaggattgtgctgaaaggtgccaggcatccttgcatcgaagtgcaagatgaggtggcc
ttcatccccaatgatgttacatttgagaagggcaagcagatgttccacattattactggc
cctaacatgggtggaaagtcaacgtatatccgacagacaggagtcattgttcttatggcc
caaattgggtgctttgtaccatgcgactctgcagaaataaccattgtggattgtatcctg
gctcgtgtaggagctggagacagtcagctgaaaggtgtgtctactttcatggctgaaatg
ttggaaactgcttcgatccttaggacagcatctgaaaactctctgataattattgatgag
ctgggaagaggaacttcgacctacgatggctttggcttggcgtgggctatttcagaatac
attgctagcaaaatttgtgctttctgtatgtttgctacacacttccatgaactgacagct
cttgctgatcaagttccaacagtaaataacctacatgttactgctctaaccagtgacgac
acactgacaatgctgtatcgtgtcaaggcaggtgtttgtgaccagagttttggaatacat
gtagcagagttggcagctttcccaaaacatgtgatagaaaatgcaagagagaaagcactg
gagctggaggagtttcaagaccttggcaggcccaaggaatctgaaggagagccagcagcc
aagaaatgctacagagaaagagaggaaggcgaaaagatcattcaggattttctctgtcaa
gtgaaagcattgcccctgacagatatgtcagaagaagacatcaaaaccaagctgaagcag
ctgagagctgatgtgttggcaaagaacaacagttttgtgaatgaaatcatttccagaaca
aaagttactccatga

DBGET integrated database retrieval system