Meleagris gallopavo (turkey): 100542972 Help Entry 100542972         CDS       T01523                                  Name (RefSeq) histone H2A type 2-B-like   KO K11251   histone H2A Organism mgp  Meleagris gallopavo (turkey) Pathway mgp03082   ATP-dependent chromatin remodeling mgp04217   Necroptosis Brite KEGG Orthology (KO) [BR:mgp00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     100542972  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100542972  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mgp03036]     100542972   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mgp04147]     100542972 Chromosome and associated proteins [BR:mgp03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100542972 Exosome [BR:mgp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100542972 SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Histone_ABTB Motif Other DBs NCBI-GeneID:  100542972 NCBI-ProteinID:  XP_003213892 Ensembl:  ENSMGAG00000016006 UniProt:  H9H207 LinkDB All DBs Position Unknown AA seq 127 aa AA seqDB search MSGRGKQSGKARSKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVMEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK SEGHKGK NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgagcgggcgagggaagcaaagcggcaaagcgcgctcgaaagccaaatcgaggtcctcc agggccggcttgcagttccctgtcggtcgagttcatcgtttgcttcgtaaagggaattac gcggaacgggtgggagccggagctccggtgtatttagcagccgtgatggaatatttgacg gctgaaattttggagttagccgggaacgcggcgagggataacaaaaagacgaggatcatc cctcggcatttgcagctggcggtgaggaacgacgaggagctgaataaattgctgggagga gtcaccatcgcgcaggggggggtcctgcccaacatccaggctgtgctgctgcccaaaaag agcgaggggcataaagggaaatga

DBGET integrated database retrieval system