Meleagris gallopavo (turkey): 100544446 Help Entry 100544446         CDS       T01523                                  Symbol MRAS Name (RefSeq) ras-related protein M-Ras   KO K07831   Ras-related protein M-Ras Organism mgp  Meleagris gallopavo (turkey) Pathway mgp04010   MAPK signaling pathway mgp04137   Mitophagy - animal mgp04140   Autophagy - animal mgp04218   Cellular senescence mgp04371   Apelin signaling pathway mgp04625   C-type lectin receptor signaling pathway mgp04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:mgp00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100544446 (MRAS)    04371 Apelin signaling pathway     100544446 (MRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100544446 (MRAS)    04137 Mitophagy - animal     100544446 (MRAS)   09143 Cell growth and death    04218 Cellular senescence     100544446 (MRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100544446 (MRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100544446 (MRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:mgp04031]     100544446 (MRAS) GTP-binding proteins [BR:mgp04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     100544446 (MRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras GTP_EFTU Roc MMR_HSR1_Xtn Arf Motif Other DBs NCBI-GeneID:  100544446 NCBI-ProteinID:  XP_010712215 Ensembl:  ENSMGAG00000011812 LinkDB All DBs Position 7:27223171..27230817 Genome browser AA seq 132 aa AA seqDB search MREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKI TREQGREMATKHNIPYIETSAKDPPLNVDKAFHDLVRVIRQQIPEKSQKKKKKTKWRGDR ATGSHKLQCTIL NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atgcgggagcagtacatgaggactggagatggtttccttatagtctactctgtgacagac aaggccagctttgagcatgtggaccgtttccaccagctgatcctcagagtcaaagacagg gagtcctttccaatgattttggtggcaaacaaagttgatctaatgcatttacggaaaatt acaagagaacagggaagagaaatggcaacaaaacataatattccgtatatagaaactagt gccaaggacccccctctaaatgttgacaaggctttccatgatcttgtaagggtaataagg caacagatcccagagaaaagccagaagaagaagaaaaagaccaaatggagaggggatcga gccacaggctcccacaaactccagtgtacaattttgtga

DBGET integrated database retrieval system