KEGG   Meleagris gallopavo (turkey): 100544942
Entry
100544942         CDS       T01523                                 

Gene name
XRCC6
Definition
(RefSeq) X-ray repair cross-complementing protein 6 isoform X1
  KO
K10884  ATP-dependent DNA helicase 2 subunit 1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    100544942 (XRCC6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mgp03041]
    100544942 (XRCC6)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100544942 (XRCC6)
Spliceosome [BR:mgp03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100544942 (XRCC6)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA-PK complex
     100544942 (XRCC6)
SSDB
Motif
Pfam: Ku_N Ku Ku_C SAP SAP_new25 SAP30_Sin3_bdg
Other DBs
NCBI-GeneID: 100544942
NCBI-ProteinID: XP_003202349
Ensembl: ENSMGAG00000012146
LinkDB
Position
1
AA seq 614 aa
MADWVSYYRGDGPDEEEDGEQQEEEGQEAVADHRFSGRDSLIFLVDASKAMFEPYEDEEA
ATPFDMTMQCIRNVYTSKIISSDKDFLSVVFYGTENNKNSAGFKHVYVLQELDNPGAKRI
LELDQYRGDEGRLLFRESFGHNADYSLGEALWACSNLFSNVQVRLSHKRIMLFTNEDNPH
ANDNAKAKLARTRAGDLRDTGIILDLMHLKKLGGFDISLFYRDIINIAEDEDLGIQPDES
GKLEHLMKKVRAKEARKRALVRLNLYLNKDLSFSVGVYNLIQKAYKPYPVKLYRETNEPV
KTKTRVFNGKTGSLLLPSDTKKAQTYGSRQIVMEKEETEEVKRFDSPGLFLIGFKPLSML
KQHHHIRPSQFIYPEESLVTGSTTLFNALLMKCLEKEVMALCRYIARRNTPPRFVALVPQ
EEELDEQKVQIAPPGFHIIFLPYADDKRNVDFTEKVPANREQVDKMKEIIQKLRFKYRTD
SFENPVLQQHFRNLEALALDMLEPEQAEDLTMPKTEEMSRRLGNLVEEFKQLVYPPDYNP
EGKAAKRKQAGDGQAEKKPKTEISEDSLRSYVQNGTLGKLTVSALKDMCRHYRLRSGGKK
QELIDALTEYFSGR
NT seq 1845 nt   +upstreamnt  +downstreamnt
atggccgactgggtgtcctattatcgtggcgacgggccggacgaggaggaggacggcgag
cagcaggaggaggagggacaggaggctgtcgcggaccacaggttctcggggcgggacagc
ttgattttcttggtcgacgcctcgaaggccatgttcgagccctacgaggatgaggaggcg
gccactccctttgacatgaccatgcagtgcatccggaatgtgtacaccagcaaaattatt
agtagtgacaaggatttcttaagtgttgtgttctatggcacggagaacaacaagaactct
gcaggcttcaagcatgtctatgtccttcaggagctggacaatccaggtgcaaagcgtatt
ctggagctggaccagtacaggggagatgaaggacgattacttttccgtgagtcctttggc
cacaatgctgactattcactgggtgaagcgctctgggcctgctctaatctcttcagcaat
gtccaagtcagactgagccacaaaaggatcatgcttttcaccaacgaggataaccctcat
gccaatgataatgctaaggccaagctggccaggaccagagctggtgatctgagagacaca
ggtattatcctggacttgatgcacttgaagaagctcggagggttcgatatctctttgttc
tacagggacatcatcaacatagcagaggatgaggaccttgggatccagcctgatgagtca
gggaaactggagcatctcatgaagaaagtacgagcaaaggaggcaaggaaacgagcttta
gtcaggttaaatctgtatttgaacaaagatctgtctttctctgttggtgtttacaacctt
attcaaaaagcttacaagccatatccagtgaaactttatcgggaaactaatgaacctgtt
aaaacaaaaacaagagtgtttaatggaaaaacaggcagtttgcttctgcctagtgataca
aaaaaggctcagacatatggaagccgccagattgtgatggagaaagaggaaaccgaagaa
gtgaaacggtttgattctccgggcttgtttctgattggcttcaaaccactttcaatgcta
aaacagcaccaccatatcaggccctcccagttcatatatcctgaagagtccctagtaact
ggcagtacaactctgtttaatgccttgttgatgaagtgcttggagaaagaggtgatggca
ctgtgcagatacatcgcccgccggaatactccccctcgctttgtggccctggttcctcag
gaggaagagttggatgagcagaaagtgcagatagctcctccaggtttccacatcattttc
ctaccatatgcagacgataaacggaacgttgattttacagaaaaggtaccagccaatcga
gaacaggtggataaaatgaaggagatcattcaaaaactccgcttcaaatacaggactgac
agctttgagaacccagttttgcagcagcacttcaggaatctggaggctttggcgctggat
atgctggaaccagaacaagctgaggatcttacaatgccgaagactgaagagatgagccgc
aggctgggcaacctggtggaggagttcaagcagctggtttatcctcctgactacaaccct
gaagggaaggctgcaaagcgaaaacaagctggtgatggtcaagcagaaaagaagcccaag
acagaaatctcagaagattcactgaggagttacgtgcagaatggcactctgggcaagctc
actgtctctgctctgaaggatatgtgcaggcattacaggctgaggagcggggggaagaag
caggagctcatagatgcactgactgagtacttcagtgggcgctaa

DBGET integrated database retrieval system