KEGG   Meleagris gallopavo (turkey): 100545174
Entry
100545174         CDS       T01523                                 

Gene name
POLL
Definition
(RefSeq) DNA polymerase lambda isoform X1
  KO
K03512  DNA polymerase lambda [EC:2.7.7.7 4.2.99.-]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03410  Base excision repair
mgp03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    100545174 (POLL)
   03450 Non-homologous end-joining
    100545174 (POLL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100545174 (POLL)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     100545174 (POLL)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.-  
     100545174 (POLL)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     100545174 (POLL)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    X-family DNA polymerases
     100545174 (POLL)
SSDB
Motif
Pfam: DNA_pol_B_palm DNA_pol_lambd_f DNA_pol_B_thumb HHH_8 BRCT_2 BRCT HHH_5 LIG3_BRCT PTCB-BRCT NTP_transf_2 HHH IMS_HHH
Other DBs
NCBI-GeneID: 100545174
NCBI-ProteinID: XP_003208120
Ensembl: ENSMGAG00000010132
LinkDB
Position
8
AA seq 616 aa
MFKMSTCCSKACLPLDAPCSSAVQQLQPNCSPGERGTARPMEPRGIVKAFPKRKKVRDDS
GKSVPPKIPKEGAEEPEAEWLKPVAAYVLQASIGQARAEIFHKQIVQNGGFVHSRLCSEV
THVIVAEDMDCDRAFRLLKLAKLPSRLQLVKASWLSDCIRDQKLLNTAGYSVFIPRRYRE
EGEQQQQQFLGSEEIQSSTEGSAAEPNVKAQVGDSSQQNPGSLAQQQPSEKVYDDEDSEG
EDASVTQGDLEALISGHYPVKLSEETSGSSSAVAQPVSKWVCAQSSHSKKENHNQCITEK
LEVLAKAYSVQGDKWRALGYAKAINALKSYHKPVTSYQEACKIPGIGKRMAEKILEILES
GHLRKLDHISESVPVLELFSNIWGAGVKTAQMWYQQGFRTLDDIRTKASLTSQQAVGLKH
YEDFLERMPREEAAEIEQTVRQAALALKPGLVCVACGSYRRGKATCGDVDVLVTHPDGQS
HRGLFSKLLDNLHESGFLTDDLVSQEDNGEQKKYLGVCRLPGPARRHRRLDIIVVPYSEF
ACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSMAVVRGPRGVKMASGHVLPTPTERDV
FTQLGLPYREPSERDW
NT seq 1851 nt   +upstreamnt  +downstreamnt
atgttcaagatgagcacatgctgctcaaaagcatgtctgcctctggatgctccttgcagc
agcgctgttcagcagctgcagcctaactgctccccaggggagcgaggcacagcccggcct
atggaaccgcgagggattgtcaaggcctttcccaagaggaagaaggtgagagatgactca
gggaaaagcgtccctccaaagatcccaaaagaaggagcggaggagcccgaggcggagtgg
ctgaaaccagtcgctgcctacgtgttgcaagctagcattggccaagccagggcagagata
ttccacaagcagattgtccagaatgggggatttgtacacagccgtctctgctcggaggtg
acgcacgtcattgtagctgaagatatggactgtgatcgggccttccggctcctcaaatta
gccaagctgccttcgaggttgcagctggtgaaggcatcctggctcagtgattgcattaga
gatcagaagctgctgaataccgctggctacagtgtctttatccctcggaggtatcgggaa
gagggagaacagcagcagcagcagttcctgggcagtgaagaaatccagtcctcaacagag
gggagtgcagcagaaccaaatgttaaagcacaggtgggggattcctcgcagcaaaacccg
ggcagccttgcacagcagcaaccatctgagaaagtctatgatgatgaagacagcgaagga
gaagatgctagtgtcactcagggagatctggaagcactgatttctggccactatcctgtg
aaattgtcagaggagaccagcggcagctcttccgcagtggcccagcctgtcagcaagtgg
gtttgtgcacagtcctcccacagcaagaaggagaatcacaaccagtgcatcacagagaag
ctggaagtgctggcaaaagcctattctgtccagggggacaagtggagagctctgggctat
gctaaagccatcaatgcactcaaaagctaccacaaaccagtcacctcctaccaggaagcc
tgtaaaattcctgggattgggaagcgaatggcagagaagatcctggagatcttggagagt
ggacatctgcgcaagctggatcatatcagtgagagtgtgcctgtactggagctattttcc
aacatctggggagcaggagtcaagacagctcagatgtggtaccagcagggcttccggaca
ctggatgatatccgcaccaaggcgtctctcaccagccagcaagccgtgggcctgaagcac
tatgaggatttcctggagcgcatgcctcgggaggaagctgcagaaatagagcagactgtc
agacaagcagccctggccttgaagcctgggctcgtgtgtgtggcatgtggctcctaccgt
cgggggaaggccacctgcggagatgtggacgtgctggtcactcacccagatggtcagtct
caccgtgggctgttcagcaagctgcttgacaacctccacgagagcggcttccttacagat
gacctggtgagtcaggaggacaatggtgagcagaagaagtacctgggggtgtgccgcctt
cctgggccggcccgtcgtcaccgacgtctggacatcatcgtggtgccttacagcgagttt
gcctgcgccctgctctacttcaccggctcggcccacttcaaccgctccatgcgtgccctg
gccaagaccaagggcatgagcctctcagagcatgccctcagcatggctgtggtgcgaggc
cctcgtggtgtcaagatggcatcaggccacgttctgcccaccccgaccgagagagatgtc
ttcactcagctggggctgccttaccgagagccctcggaacgggactggtga

DBGET integrated database retrieval system