Meleagris gallopavo (turkey): 100545528 Help Entry 100545528         CDS       T01523                                  Symbol NPS Name (RefSeq) neuropeptide S   KO K25691   neuropeptide S Organism mgp  Meleagris gallopavo (turkey) Pathway mgp04080   Neuroactive ligand-receptor interaction Brite KEGG Orthology (KO) [BR:mgp00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     100545528 (NPS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mgp04052]     100545528 (NPS) Cytokines and neuropeptides [BR:mgp04052]  Neuropeptides   GPCR binding    100545528 (NPS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Neuropeptide_S Motif Other DBs NCBI-GeneID:  100545528 NCBI-ProteinID:  XP_031410388 LinkDB All DBs Position 8:29272468..29278723 Genome browser AA seq 83 aa AA seqDB search MFVCSGYPVGPSMSSNPFYLNCQLYGKSDYCLVLLNSCLAKVGRSEELALLKPPLLEMPF NKRSFRNGVGSGIKKTSFRRAKS NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgtttgtgtgctcgggttacccagttggcccttccatgagcagcaatcctttttatttg aattgccagctgtatggaaaatctgattactgcctggtgctgctgaatagctgcttagcc aaggtgggcaggagcgaagagctggctctcctaaagcctcccctcctggagatgcctttc aacaaacggtcctttcgcaatggtgtgggatcaggaattaaaaaaacttcctttcgaaga gcaaaatcataa

DBGET integrated database retrieval system