Meleagris gallopavo (turkey): 100545600 Help Entry 100545600         CDS       T01523                                  Name (RefSeq) C-C motif chemokine 3-like   KO K05408   C-C motif chemokine 3 Organism mgp  Meleagris gallopavo (turkey) Pathway mgp04060   Cytokine-cytokine receptor interaction mgp04620   Toll-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:mgp00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100545600  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100545600  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mgp04052]     100545600    00536 Glycosaminoglycan binding proteins [BR:mgp00536]     100545600 Cytokines and neuropeptides [BR:mgp04052]  Cytokines   Chemokines    100545600 Glycosaminoglycan binding proteins [BR:mgp00536]  Heparan sulfate / Heparin   Chemokines    100545600 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  100545600 NCBI-ProteinID:  XP_003211755 LinkDB All DBs Position 21:complement(985369..986364) Genome browser AA seq 91 aa AA seqDB search MKGPAAVLTALLLLALCSSAVAHLDGLPTTCCFSYVQRPIPRNVIASAFPTSSKCRLPAV ILITKKGKEVCANPEESWVQKRLELFQNQEN NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaagggccccgcagccgtcctgaccgctctgctcctcctggccctctgctcctcggct gtggcccatctggatggcctacccacaacctgctgcttctcctatgttcaacgtcccatc ccacgcaacgtcattgcttctgccttccccaccagcagcaaatgccgcctgccggcagtg atcctgatcaccaagaaggggaaggaggtatgtgcaaaccccgaggagtcctgggtgcag aaacgcctggaactgttccagaaccaagaaaactga

DBGET integrated database retrieval system