Meleagris gallopavo (turkey): 100546152 Help Entry 100546152         CDS       T01523                                  Symbol CALML4 Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism mgp  Meleagris gallopavo (turkey) Pathway mgp04020   Calcium signaling pathway mgp04070   Phosphatidylinositol signaling system mgp04114   Oocyte meiosis mgp04218   Cellular senescence mgp04261   Adrenergic signaling in cardiomyocytes mgp04270   Vascular smooth muscle contraction mgp04371   Apelin signaling pathway mgp04625   C-type lectin receptor signaling pathway mgp04744   Phototransduction mgp04910   Insulin signaling pathway mgp04912   GnRH signaling pathway mgp04916   Melanogenesis Brite KEGG Orthology (KO) [BR:mgp00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     100546152 (CALML4)    04020 Calcium signaling pathway     100546152 (CALML4)    04070 Phosphatidylinositol signaling system     100546152 (CALML4)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     100546152 (CALML4)    04218 Cellular senescence     100546152 (CALML4)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100546152 (CALML4)   09152 Endocrine system    04910 Insulin signaling pathway     100546152 (CALML4)    04912 GnRH signaling pathway     100546152 (CALML4)    04916 Melanogenesis     100546152 (CALML4)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     100546152 (CALML4)    04270 Vascular smooth muscle contraction     100546152 (CALML4)   09157 Sensory system    04744 Phototransduction     100546152 (CALML4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mgp01009]     100546152 (CALML4)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mgp04131]     100546152 (CALML4)    03036 Chromosome and associated proteins [BR:mgp03036]     100546152 (CALML4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mgp04147]     100546152 (CALML4) Protein phosphatases and associated proteins [BR:mgp01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      100546152 (CALML4) Membrane trafficking [BR:mgp04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     100546152 (CALML4) Chromosome and associated proteins [BR:mgp03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      100546152 (CALML4) Exosome [BR:mgp04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    100546152 (CALML4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_11 HI0933_like_1st Cmr2_hel_dom2 EF_EFCAB10_C Motif Other DBs NCBI-GeneID:  100546152 NCBI-ProteinID:  XP_003209638 LinkDB All DBs Position 12:complement(18396746..18398370) Genome browser AA seq 117 aa AA seqDB search MRCLGVSPTPAEAQRHLHLHKIERNAELDFSTFLNIMYRQMKQEEPEKEILTALAMIDRE KRGLISAAELRAKLTRLGEKLSEEEVDDLLKEAKIGPNGTIKYEEFTRTICLPAVDY NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgcgctgcctgggggtcagccccacgccggctgaggcgcagcggcacctgcacctgcac aagatcgagcgcaatgcagagctggacttctccaccttcctcaacatcatgtacaggcag atgaagcaggaggagcctgagaaggagatcctgacggcgctggccatgatcgatcgggag aagcgagggctgatctctgctgctgagctgcgggcaaagctgacacgactgggggagaaa ctgtccgaggaagaggtcgatgacctgctgaaagaagccaaaatcggaccgaatggaaca atcaaatacgaagagttcacccgcaccatttgcctccctgcagtcgattactga

DBGET integrated database retrieval system