Meleagris gallopavo (turkey): 100546858 Help Entry 100546858         CDS       T01523                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism mgp  Meleagris gallopavo (turkey) Pathway mgp04010   MAPK signaling pathway mgp04012   ErbB signaling pathway mgp04068   FoxO signaling pathway mgp04137   Mitophagy - animal mgp04140   Autophagy - animal mgp04144   Endocytosis mgp04150   mTOR signaling pathway mgp04210   Apoptosis mgp04218   Cellular senescence mgp04370   VEGF signaling pathway mgp04371   Apelin signaling pathway mgp04510   Focal adhesion mgp04540   Gap junction mgp04625   C-type lectin receptor signaling pathway mgp04810   Regulation of actin cytoskeleton mgp04910   Insulin signaling pathway mgp04912   GnRH signaling pathway mgp04916   Melanogenesis mgp05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mgp00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100546858 (HRAS)    04012 ErbB signaling pathway     100546858 (HRAS)    04370 VEGF signaling pathway     100546858 (HRAS)    04371 Apelin signaling pathway     100546858 (HRAS)    04068 FoxO signaling pathway     100546858 (HRAS)    04150 mTOR signaling pathway     100546858 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100546858 (HRAS)    04140 Autophagy - animal     100546858 (HRAS)    04137 Mitophagy - animal     100546858 (HRAS)   09143 Cell growth and death    04210 Apoptosis     100546858 (HRAS)    04218 Cellular senescence     100546858 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100546858 (HRAS)    04540 Gap junction     100546858 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100546858 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100546858 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     100546858 (HRAS)    04912 GnRH signaling pathway     100546858 (HRAS)    04916 Melanogenesis     100546858 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100546858 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mgp04131]     100546858 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mgp04147]     100546858 (HRAS)    04031 GTP-binding proteins [BR:mgp04031]     100546858 (HRAS) Membrane trafficking [BR:mgp04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     100546858 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     100546858 (HRAS) Exosome [BR:mgp04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    100546858 (HRAS)   Exosomal proteins of colorectal cancer cells    100546858 (HRAS) GTP-binding proteins [BR:mgp04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     100546858 (HRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  100546858 NCBI-ProteinID:  XP_010709457 UniProt:  G1NAA3 LinkDB All DBs Position 5:15172182..15188550 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtagtagtgggagctggaggcgttgggaagagcgctttgaca atacagctcattcagaaccattttgttgatgagtacgaccccacaatagaggattcctac agaaagcaagtcgtcatcgatggagagacctgtttgctggacatcctggatacggcagga caagaggagtacagtgccatgcgagaccagtacatgagaacgggggaaggattcctgtgc gtctttgccattaacaacaccaagtcctttgaggacatccaccagtacagggagcagatc aagagggtgaaagactcagatgatgttcccatggtgctggtgggaaataaatgtgacctg ccagcacggacagtggagactcggcaagcgcaggacctggcccggagttatgggatcccc tacatagaaacgtcagccaaaaccagacagggcgttgaagatgccttctataccttagtg cgggagatccgtcagcataaactgcgcaagctgaacccaccagatgagagtggccctggc tgcatgaactgtaaatgcgtgatatcgtga

DBGET integrated database retrieval system