Meleagris gallopavo (turkey): 100547062 Help Entry 100547062         CDS       T01523                                  Symbol RRAS2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism mgp  Meleagris gallopavo (turkey) Pathway mgp04010   MAPK signaling pathway mgp04137   Mitophagy - animal mgp04140   Autophagy - animal mgp04218   Cellular senescence mgp04371   Apelin signaling pathway mgp04625   C-type lectin receptor signaling pathway mgp04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:mgp00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100547062 (RRAS2)    04371 Apelin signaling pathway     100547062 (RRAS2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100547062 (RRAS2)    04137 Mitophagy - animal     100547062 (RRAS2)   09143 Cell growth and death    04218 Cellular senescence     100547062 (RRAS2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100547062 (RRAS2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100547062 (RRAS2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mgp04147]     100547062 (RRAS2)    04031 GTP-binding proteins [BR:mgp04031]     100547062 (RRAS2) Exosome [BR:mgp04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    100547062 (RRAS2)   Exosomal proteins of bladder cancer cells    100547062 (RRAS2) GTP-binding proteins [BR:mgp04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     100547062 (RRAS2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf ATP_bind_1 MMR_HSR1 Motif Other DBs NCBI-GeneID:  100547062 NCBI-ProteinID:  XP_010709222 Ensembl:  ENSMGAG00000006557 UniProt:  G1N459 LinkDB All DBs Position 5:complement(6986238..7007581) Genome browser AA seq 170 aa AA seqDB search MVSYFVTDYDPTIEDSYTKQCVIDERAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFS VTDRGSFEEIYKFQRQILRVKDRDEFPMILVGNKADLDHQRQVTQEEGQQLARQLKVTYM EASAKIRLNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atggtatcctattttgttacggattatgaccctacaatcgaagactcctacaccaaacaa tgtgtgatagatgaaagagctgcgcgcttggacattctggatacagccggacaagaagaa tttggagccatgcgtgaacagtacatgaggacaggagagggttttctcctggttttctca gtcactgatagaggaagttttgaagaaatctataagtttcaacgacaaattcttagagtg aaagatcgtgatgagtttcctatgattctagttggtaataaagcagatctggaccaccaa agacaggtgacacaagaggaaggtcagcagctagcacgacaacttaaagtaacgtacatg gaagcctcagcaaagatcagattgaatgtagaccaagcttttcatgaacttgtcagagtt ataaggaaatttcaagaacaagagtgccctccttcaccagagccaacacggaaagagaaa gacaaaaaaggctgccattgtgtaattttctga

DBGET integrated database retrieval system