Meleagris gallopavo (turkey): 100547062 Help Entry 100547062         CDS       T01523                                  Symbol RRAS2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism mgp  Meleagris gallopavo (turkey) Pathway mgp04010   MAPK signaling pathway mgp04137   Mitophagy - animal mgp04140   Autophagy - animal mgp04218   Cellular senescence mgp04371   Apelin signaling pathway mgp04519   Cadherin signaling mgp04625   C-type lectin receptor signaling pathway mgp04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:mgp00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100547062 (RRAS2)    04371 Apelin signaling pathway     100547062 (RRAS2)   09133 Signaling molecules and interaction    04519 Cadherin signaling     100547062 (RRAS2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100547062 (RRAS2)    04137 Mitophagy - animal     100547062 (RRAS2)   09143 Cell growth and death    04218 Cellular senescence     100547062 (RRAS2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100547062 (RRAS2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100547062 (RRAS2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mgp04147]     100547062 (RRAS2)    04031 GTP-binding proteins [BR:mgp04031]     100547062 (RRAS2) Exosome [BR:mgp04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    100547062 (RRAS2)   Exosomal proteins of bladder cancer cells    100547062 (RRAS2) GTP-binding proteins [BR:mgp04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     100547062 (RRAS2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf ATP_bind_1 MMR_HSR1 RHG35-p190PhoGP_pG1 Motif Other DBs NCBI-GeneID:  100547062 NCBI-ProteinID:  XP_010709222 Ensembl:  ENSMGAG00000006557 UniProt:  G1N459 LinkDB All DBs Position 5:complement(6986238..7007581) Genome browser AA seq 170 aa AA seqDB search MVSYFVTDYDPTIEDSYTKQCVIDERAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFS VTDRGSFEEIYKFQRQILRVKDRDEFPMILVGNKADLDHQRQVTQEEGQQLARQLKVTYM EASAKIRLNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atggtatcctattttgttacggattatgaccctacaatcgaagactcctacaccaaacaa tgtgtgatagatgaaagagctgcgcgcttggacattctggatacagccggacaagaagaa tttggagccatgcgtgaacagtacatgaggacaggagagggttttctcctggttttctca gtcactgatagaggaagttttgaagaaatctataagtttcaacgacaaattcttagagtg aaagatcgtgatgagtttcctatgattctagttggtaataaagcagatctggaccaccaa agacaggtgacacaagaggaaggtcagcagctagcacgacaacttaaagtaacgtacatg gaagcctcagcaaagatcagattgaatgtagaccaagcttttcatgaacttgtcagagtt ataaggaaatttcaagaacaagagtgccctccttcaccagagccaacacggaaagagaaa gacaaaaaaggctgccattgtgtaattttctga

DBGET integrated database retrieval system