KEGG   Meleagris gallopavo (turkey): 100548655
Entry
100548655         CDS       T01523                                 

Gene name
MUTYH
Definition
(RefSeq) adenine DNA glycosylase
  KO
K03575  A/G-specific adenine glycosylase [EC:3.2.2.31]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    100548655 (MUTYH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100548655 (MUTYH)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.31  adenine glycosylase
     100548655 (MUTYH)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     100548655 (MUTYH)
 Prokaryotic type
     100548655 (MUTYH)
SSDB
Motif
Pfam: HhH-GPD NUDIX_4 HHH EndIII_4Fe-2S
Other DBs
NCBI-GeneID: 100548655
NCBI-ProteinID: XP_010714623
Ensembl: ENSMGAG00000010370
LinkDB
Position
10
AA seq 500 aa
MAERRNGGFRVAPTGEGSRKGASLREEAPARPHALHLFGDPVEIDALRGRLLTWYDKSRR
DLPWRALAAAEPDADRRAYAVWVSEIMLQQTQVATVIDYYNRWMQKWPTLEALAAASLEE
VNELWAGLGYYSRGKRLQEAARKVVSELAGRMPRTAEDLQRLLPGVGRYTAGAIASISFG
QATGVVDGNVIRVLCRLRCIGADTSSLAVIDCLWNMANILVDRSRPGDFNQALMELGATV
CTPKSPLCGECPVKEHCHAWHRMEKELASASQKLFRKTTLVPDVEDCGIGDCLLCLPAAE
LWDSSLGVTNFPRKAAKKQPRVERTATCVLERRGHLGVPEYLIVQRPSSGLLAGLWEFPS
FPLAPGLQEEQQKEMLADHLRVWTRQPVQTQSLCFVGEVVHIFSHIHQTYVVYSLCLDGD
VVLDAASSPSRWVTEEEFRASAVSTAMKKVLKARETQRGVQSGRAKGSKRKRESKLGAAG
STPTGIQLSLRAFLRAQTDP
NT seq 1503 nt   +upstreamnt  +downstreamnt
atggcagagagaagaaacggaggtttccgcgtggccccgactggggagggcagcaggaag
ggcgcgtcgctccgtgaagaggctcccgcgcgaccacatgcgctgcatctcttcggtgac
cccgtcgagatcgatgctctacgtggccgcctgctcacctggtatgacaaaagccggcgg
gaccttccttggagggcgctggctgcagctgagccagatgctgacaggcgggcgtatgca
gtgtgggtgtctgagatcatgcttcagcagacacaagtggctacggtgatcgactactac
aaccgctggatgcagaagtggccaacactggaagcgctggcagcagcatcgctggaggag
gtgaatgagctgtgggcaggactcggctactactcacgaggaaaacgcctgcaggaggca
gcaaggaaggtggtgtcagagctggccggccgcatgcccaggacagctgaggacctgcag
aggctgctgccaggagtgggtcgatacacagcaggagccattgcgtccatctcatttgga
caggctaccggtgtcgtggatgggaatgtgatccgtgtgctgtgccgcctgcggtgcatt
ggtgctgacaccagcagcctggctgtcattgactgcctctggaacatggccaacatcttg
gtggataggagccggccaggggacttcaaccaagctctgatggagctgggggcaactgta
tgcacacccaaatccccactgtgtggggagtgcccagtgaaggagcactgccatgcctgg
cataggatggagaaggagctggcctctgcctctcagaagctgtttagaaagaccaccctg
gtgcctgatgttgaggactgcgggattggagactgtctgttgtgccttcctgctgccgag
ctgtgggacagcagcctgggggtcaccaacttcccccgcaaagcagcaaagaagcagcca
cgagtggagcggacagccacatgtgtgctggagcggaggggccaccttggggtccctgag
tacctcattgtgcagagacccagctcagggctcctggctgggctctgggaattccccagc
ttccctctggctccgggcctgcaggaggagcagcagaaggagatgctggctgaccacctg
cgggtatggacaaggcagcctgtgcagacacagagtttgtgcttcgtcggagaggttgtc
cacatcttctctcacattcaccagacgtatgtggtctactcactgtgcctggatggggat
gtggtcctggatgctgcctcgtccccatcccgctgggtgacagaggaggaattccgtgcc
tcggctgtgtccactgccatgaagaaggtgctgaaggcgcgggagactcagcgtggggtg
cagagcggccgtgccaagggctccaagcggaagcgggagtcaaagctgggggcagcaggc
agcacccccacagggattcagctctccctgcgcgccttcctccgggcacagactgatccg
tga

DBGET integrated database retrieval system