KEGG   Meleagris gallopavo (turkey): 100549534
Entry
100549534         CDS       T01523                                 

Gene name
RAD50
Definition
(RefSeq) DNA repair protein RAD50 isoform X2
  KO
K10866  DNA repair protein RAD50 [EC:3.6.-.-]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03440  Homologous recombination
mgp03450  Non-homologous end-joining
mgp04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    100549534 (RAD50)
   03450 Non-homologous end-joining
    100549534 (RAD50)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100549534 (RAD50)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mgp03032]
    100549534 (RAD50)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100549534 (RAD50)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.-  Acting on acid anhydrides
    3.6.-.-  
     100549534 (RAD50)
DNA replication proteins [BR:mgp03032]
 Eukaryotic type
  DNA Replication Termination Factors
   MRN complex
    100549534 (RAD50)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     100549534 (RAD50)
    BRCA1-C complex
     100549534 (RAD50)
   NHEJ (non-homologous end-joining)
    MRX complex
     100549534 (RAD50)
SSDB
Motif
Pfam: AAA_23 Rad50_zn_hook AAA_15 SMC_N AAA_21 SbcCD_C DUF2703 AAA_29 AAA_16
Other DBs
NCBI-GeneID: 100549534
NCBI-ProteinID: XP_003210540
Ensembl: ENSMGAG00000008972
LinkDB
Position
15
AA seq 1312 aa
MAKIEKMSILGVRSFGVEDKDKQIITFFNPLTILVGPNGAGKTTIIECLKYISTGDFPPG
TKGNLFVHDPKVANETDVRAQIRLQFRDVNGELVAVQRSMVCTQKSKKTEFKTLEGVITR
TKHGEKVSLSSKCAEIDREMISALGVSKSVLNNVIFCHQEESNWPLSEGKALKQKFDEIF
SATRYIKALETLRQVRLKQGMKVKECQTELKYLKQNKEKAQEIQDNLANTEAQLSASKEN
IKSIESQLDPLKSSLAAVEKNLAKVMSLDNDVKALESRRRQMEKDNQDLQQKMEKVFQGT
DEQLRDRYKNHQRTVKEKEKRLSDCKRELDRASKECQRFNNEKSELLIERGRLQLQADRH
QEHIKVRDSLIQSLSAQLELDGFEQAPFNDRQIAVFHELLKERQKSDTEAANQLMREFTQ
KEAMKQKQIDEIRDRKTGLERTIDLKSDIQNKRQAELKNVKYELRQLEGSSDRIVELDQE
IIKTEHELEKAERNSNVETLEQEVQTLQNEKINLDKVLRRLDQEMEQLNLHTTTITQMEM
LKKDKADKEEQIRKVKLRHSEELTLLLGYFPNKKQLEDWLHGKSTEINETRNKHALLNKQ
LASAEQQKNYISAELRKKEEQLSSYEAKLFDVCGSQDFDSNLNKLQDEIERSSKQRAVLA
GATAVYSQFITQLTEENQSCCPVCQRVFQTEAELQDVISDLQSKLRLAPDKLKSTEFELK
KREKKRDEMMGLKPIRQTVAELQERDIPDLRNRLQTVNRDFARLKGEIEEQETLLQTVLS
EKEGANACLQDITLMERYQTDIRDVERKIAQQEAKLLGVDLNRTVLQVSQEKQEKKHLWD
TVTSKIELNQKMKQEQQNQIQELKSTVNELRAEKLQISSSLQRRQQLEEQTVELTTEVQS
LYREIKEAKEQIFPLDATLEKLQQDKEDLINKRTASNKEIQEKMNGIKEKVKDINKYMKE
IESYIQQGKEEYKKQKECELDEVNSQLAACEKQKEKISKEMEIIRQDIDTQKIQERWLED
NLTLRQRNEELKRVEDDIKQLVKEMGEMKVPQLKNEQKHFEEKIEALKRNHHVAQGRQRG
FEEQIVRFKKELRESQFKDAEEKHREMMIVMRTTELVNKDLDIYYKALDKAIMTFHSMKM
QEINKIIRDLWRSTYRGQDIEYIEIRSDADENVSASDKRRSYNYRVVMIKGDTALDMRGR
CSAGQKVLASLIIRLALAETFCLNCGILALDEPTTNLDRENIESLAHALVEIIKSRSRQR
NFQLLVITHDEDFVELLSRSEYVETFYRIKKNIDQCSEIMKCSVSSLGSYVH
NT seq 3939 nt   +upstreamnt  +downstreamnt
atggccaagattgagaaaatgagcatcctgggagtgaggagtttcggtgtggaggacaaa
gacaaacaaattatcaccttctttaatcccctgactattctggtgggacccaacggcgca
gggaaaacgaccatcatcgagtgccttaaatacatctccactggagatttccctcctggt
accaaaggaaatttgtttgttcatgacccaaaggttgccaacgaaacagatgtgagagct
cagattcgactgcagtttcgagatgttaatggagagctcgtagctgtccaacgatccatg
gtttgtacccagaaaagcaagaaaacagaatttaaaacacttgaaggggtcattaccaga
acaaagcatggcgagaaggtcagtctcagttccaagtgtgcagaaattgatcgggagatg
atcagtgccctcggcgtttccaagtcagtgcttaacaatgtcattttctgccaccaagaa
gaatccaactggccattaagcgaagggaaggccctgaaacaaaagtttgatgagatcttc
tcagcaacaaggtatattaaagcactggaaaccctccgtcaagtacggctgaagcaaggc
atgaaagtaaaagagtgtcagacagaactgaaatacctaaaacagaataaagaaaaagcc
caggaaatccaggacaatcttgccaacacagaagctcagctgtctgcttctaaggagaat
ataaaatctattgagagccagctcgaccccttaaagagttctctggcagcagttgagaag
aatctcgcaaaagtaatgtcactggacaacgatgtgaaagccctggagagcaggaggagg
cagatggaaaaggataatcaagatctgcaacagaaaatggaaaaggtttttcaaggaaca
gacgaacagctcagggacagatacaagaaccaccagagaacagtgaaggaaaaggagaag
aggttatcagactgtaagcgagaattagatagagcctctaaagaatgccagaggtttaac
aatgagaagtcagaactacttattgaacgaggtcgtctacagctgcaagcagatcgtcac
caagagcacatcaaagtgagggattccttaattcagtctttgtcagcacagctggaatta
gatggctttgagcaggcaccttttaatgacagacagattgctgtttttcatgagctattg
aaagagaggcagaagagtgatacagaagctgcaaatcagttaatgagagagttcacacag
aaagaagcaatgaaacaaaagcagattgatgaaataagagataggaagactgggttagag
agaaccattgacctgaaatcagacattcaaaataagaggcaggctgaactgaagaatgta
aagtatgagctgcgtcagttggagggctcttcagacagaatagtggagttggatcaggag
atcataaagacggagcatgagctggagaaagctgagaggaacagcaatgtagaaactctg
gaacaggaagtgcaaactctgcagaatgagaaaatcaacctggacaaagttcttcggagg
ttggaccaggagatggagcagctgaatctacataccacaactattacccaaatggagatg
ctgaagaaagacaaagcagacaaagaggagcagattagaaaagtaaaattgagacattct
gaagaactgacactactgctggggtatttcccaaacaaaaaacaacttgaagactggctt
catggcaaaagcactgagattaacgagacaaggaataaacatgccctgctaaacaaacaa
ctggcttcagcagaacagcagaaaaattacatcagtgctgaactaagaaaaaaagaagaa
cagttgtccagctatgaagcaaagctttttgatgtttgtggaagccaagattttgacagt
aacctgaacaaactgcaagatgagattgaaagaagttcaaagcagcgagctgtgcttgct
ggagccactgcagtttattcacagttcattacacagctgacagaggagaaccagtcgtgt
tgtccagtttgccaaagagtttttcaaacagaggctgaactgcaagatgtgatcagtgat
ctgcagtcaaagctgcgtctcgccccagacaaactgaagtcaacagagtttgagcttaaa
aaaagagagaaaaaacgtgatgagatgatgggtcttaaaccaattaggcaaactgtagcg
gaactccaagaaagggacataccagacttgaggaacaggctgcagactgtgaacagggat
tttgcacgcctgaagggtgagatagaagaacaggaaacacttttgcaaacagttctgtct
gaaaaggaaggtgctaatgcatgtttgcaggacataactctcatggaaaggtaccagact
gatattagggacgttgaaagaaaaattgctcagcaggaggctaagctgctaggggtcgat
ttaaatagaactgttctgcaagtaagccaagagaaacaagagaaaaaacacttgtgggat
acagttaccagtaaaattgagttaaatcagaaaatgaagcaagagcagcaaaatcaaatt
caggagctgaagagtacagtgaatgaactcagagcagagaaacttcagatttccagcagc
ttgcagcgtcgtcagcaactggaggaacaaacagtggaattaaccactgaagttcagtcc
ttatacagagagatcaaggaagcaaaagaacagatatttcctctggatgcaactttagaa
aaactgcagcaagacaaggaggatctaattaataaaaggactgcaagtaataaagaaata
caagagaagatgaatggcataaaagagaaagttaaagatataaataagtacatgaaagaa
attgaaagctatattcaacaaggaaaggaagaatacaagaagcaaaaggagtgtgaactc
gatgaagtaaattctcagttagctgcctgtgagaaacagaaggaaaagattagtaaagag
atggaaattattcgacaggatattgacactcaaaaaatccaggagagatggctggaggat
aatcttactttgaggcagcggaatgaagagctaaaaagagttgaagacgatataaaacaa
cttgtcaaggagatgggagaaatgaaagttccacagctgaaaaacgaacaaaaacatttc
gaggagaaaatagaagctctgaaaagaaaccatcacgttgcacagggccgacagcgtgga
tttgaggaacagattgttcggtttaaaaaggagcttcgagagtcacagttcaaggatgca
gaggaaaagcacagggagatgatgattgttatgagaacaacagagctggtgaacaaagat
ttggacatttattacaaggccctcgataaagccataatgacatttcatagcatgaagatg
caagaaatcaacaaaataatccgcgacctttggcgaagtacctacagaggacaagatatt
gaatatatagaaattcgttctgatgcagatgaaaacgtttcggcatctgataaaagaaga
agttacaattacagagtggtgatgataaagggagatacggcgctggatatgcgaggaagg
tgcagtgctgggcaaaaggtacttgcttctcttatcatccgtctcgctctggcagaaacg
ttctgcctcaactgtggcatattggcactggatgagcctaccaccaatcttgatcgagaa
aatatagaatctcttgcacacgcccttgtggagataataaaaagccgctcacgacaacgg
aactttcagctcctggtgataacccacgatgaagattttgtggaactcctcagccgttct
gaatatgtggaaaccttctacaggatcaagaagaacattgatcagtgctctgagatcatg
aagtgcagcgtcagctcccttggctcatatgttcattaa

DBGET integrated database retrieval system