Meleagris gallopavo (turkey): 100549999 Help Entry 100549999         CDS       T01523                                  Symbol POLE3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism mgp  Meleagris gallopavo (turkey) Pathway mgp03030   DNA replication mgp03082   ATP-dependent chromatin remodeling mgp03410   Base excision repair mgp03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:mgp00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     100549999 (POLE3)    03410 Base excision repair     100549999 (POLE3)    03420 Nucleotide excision repair     100549999 (POLE3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     100549999 (POLE3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:mgp03032]     100549999 (POLE3)    03036 Chromosome and associated proteins [BR:mgp03036]     100549999 (POLE3)    03400 DNA repair and recombination proteins [BR:mgp03400]     100549999 (POLE3) Enzymes [BR:mgp01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      100549999 (POLE3) DNA replication proteins [BR:mgp03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     100549999 (POLE3) Chromosome and associated proteins [BR:mgp03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     100549999 (POLE3) DNA repair and recombination proteins [BR:mgp03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       100549999 (POLE3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C BUD22 SpoU_methylase CIS_TMP RNA_pol_3_Rpc31 DUF4746 NOA36 Afi1 CDC45 PFF1_TM Motif Other DBs NCBI-GeneID:  100549999 NCBI-ProteinID:  XP_010719028 Ensembl:  ENSMGAG00000001864 UniProt:  A0A803YA40 LinkDB All DBs Position 19:1315304..1318506 Genome browser AA seq 143 aa AA seqDB search MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGK RKTLNAGDVLSAMEEMEFQRFIAPLKESLEVYRREQKGKKEARKDKDKKADSEEQDKSRE DDNDDDDERMEEEEQNDEEEVDN NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atggcggagagaccggaggatctcaacctgcccaacgccgtcatcacccgcatcatcaaa gaggcgctgcctgatggggtgaacatatccaaagaagctcggagcgcaatatctcgagca gcaagtgtgtttgtgctgtatgcaacatcatgtgcaaataactttgccatgaaggggaag aggaaaacgctgaatgctggtgatgttctctctgccatggaggaaatggagtttcagcga tttatagcccctttgaaagagtccctggaagtttacagacgtgaacagaagggaaagaaa gaagcgaggaaagataaagacaagaaggcagactcagaggaacaagataagagccgagaa gatgataatgatgatgatgatgaaaggatggaggaagaagagcaaaatgatgaggaagag gtggacaactga

DBGET integrated database retrieval system