KEGG   Meleagris gallopavo (turkey): 100550883
Entry
100550883         CDS       T01523                                 

Gene name
SSBP1
Definition
(RefSeq) single-stranded DNA-binding protein, mitochondrial
  KO
K03111  single-strand DNA-binding protein
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03030  DNA replication
mgp03430  Mismatch repair
mgp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100550883 (SSBP1)
   03430 Mismatch repair
    100550883 (SSBP1)
   03440 Homologous recombination
    100550883 (SSBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mgp03032]
    100550883 (SSBP1)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100550883 (SSBP1)
   03029 Mitochondrial biogenesis [BR:mgp03029]
    100550883 (SSBP1)
DNA replication proteins [BR:mgp03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    100550883 (SSBP1)
DNA repair and recombination proteins [BR:mgp03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     100550883 (SSBP1)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    100550883 (SSBP1)
Mitochondrial biogenesis [BR:mgp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    100550883 (SSBP1)
SSDB
Motif
Pfam: SSB
Other DBs
NCBI-GeneID: 100550883
NCBI-ProteinID: XP_003202469
LinkDB
Position
1
AA seq 147 aa
FLSVLQVFRQLVRHESGDTVGSLVLERSMNRVQLLGRVGQDPIMRQVDGKNPVTIFSLAT
NEMWRTGENEVAQTGDISQKTTWHRISVFRPGLRDVTYQYVKKGSRLYVEGKLDYGEYTD
KNNVRRQATTIIADNVIFLSDNIKEKV
NT seq 444 nt   +upstreamnt  +downstreamnt
tttctgtctgttcttcaggtgttccgtcagttggtgagacatgagtctggtgatacagtc
ggctcgttagtactggaacgatccatgaatcgtgttcagttacttggtcgggttggacag
gaccctatcatgaggcaagtggatggaaaaaatcctgttaccatattttctcttgcaacc
aatgagatgtggcggacaggagaaaatgaggtagcacagacaggtgatatcagtcagaag
acaacatggcacaggatctctgtcttcagaccaggcctcagagatgttacgtatcaatat
gtgaagaagggttctcggctgtatgttgaagggaaactagactatggtgaatatacagat
aaaaacaacgtgaggcggcaggcgacaacaattattgcagataacgtaatttttctgagt
gataatatcaaagaaaaggtatga

DBGET integrated database retrieval system