Meleagris gallopavo (turkey): 100551381 Help Entry 100551381         CDS       T01523                                  Name (RefSeq) fibroblast growth factor 1-like   KO K18496   fibroblast growth factor 1 Organism mgp  Meleagris gallopavo (turkey) Pathway mgp04010   MAPK signaling pathway mgp04020   Calcium signaling pathway mgp04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:mgp00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100551381    04020 Calcium signaling pathway     100551381  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100551381  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mgp04052]     100551381    00536 Glycosaminoglycan binding proteins [BR:mgp00536]     100551381 Cytokines and neuropeptides [BR:mgp04052]  Cytokines   Growth factors (RTK binding)    100551381 Glycosaminoglycan binding proteins [BR:mgp00536]  Heparan sulfate / Heparin   Growth factors/receptors    100551381 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  100551381 NCBI-ProteinID:  XP_010717531 Ensembl:  ENSMGAG00000015458 LinkDB All DBs Position 15:complement(15739197..15741614) Genome browser AA seq 102 aa AA seqDB search MAEGEITTFTALTERFGLPLGNYKKPKLLYCSNGGHFLRILPDGKVDGTRDRSDQHSKDR PGCLALLRVCMPCIAWSALPAEATWHGCAGGCAAGRGSQKGC NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggccgagggggagataaccaccttcacagccctgaccgagcgcttcggcctgccgctg ggcaactacaagaagcccaaactcctgtactgcagcaacgggggccacttcctacggatc ctgccggacggcaaggtggacgggacgcgggaccggagcgaccagcacagtaaggaccgg ccgggctgcttggctctcctgcgtgtttgcatgccctgcattgcttggtcagccttacca gcagaagcaacctggcacgggtgtgcaggcggctgtgcagccgggaggggcagccagaag gggtgctaa

DBGET integrated database retrieval system