KEGG   Meleagris gallopavo (turkey): 100551390
Entry
100551390         CDS       T01523                                 

Symbol
PCNA
Name
(RefSeq) proliferating cell nuclear antigen
  KO
K04802  proliferating cell nuclear antigen
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03030  DNA replication
mgp03410  Base excision repair
mgp03420  Nucleotide excision repair
mgp03430  Mismatch repair
mgp04110  Cell cycle
mgp04530  Tight junction
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100551390 (PCNA)
   03410 Base excision repair
    100551390 (PCNA)
   03420 Nucleotide excision repair
    100551390 (PCNA)
   03430 Mismatch repair
    100551390 (PCNA)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100551390 (PCNA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100551390 (PCNA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mgp03032]
    100551390 (PCNA)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100551390 (PCNA)
DNA replication proteins [BR:mgp03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    100551390 (PCNA)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100551390 (PCNA)
   MMR (mismatch excision repair)
    Other MMR factors
     100551390 (PCNA)
  TLS (translesion DNA synthesis) factors
   Other TLS factors
    100551390 (PCNA)
SSDB
Motif
Pfam: PCNA_C PCNA_N Rad1 Rad9 Hus1 FmdE
Other DBs
NCBI-GeneID: 100551390
NCBI-ProteinID: XP_003212427
LinkDB
Position
24
AA seq 262 aa
MFEARLVQGSVLKRVLEALKDLITEACWDLGSGGISLQSMDSSHVSLVQLTLRSEGFDTY
RCDRNIAMGVNLNSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD
LDVEQLGIPEQEYSCVVKMPSAEFARICRDLSHIGDAVVISCAKDGVKFSANGELGNGNI
KLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSPTVTLSMSADVPLVVEYK
IADMGHLKYYLAPKIEDQQEGS
NT seq 789 nt   +upstreamnt  +downstreamnt
atgttcgaggcgcggcttgtgcagggctcggtgctcaagcgggtgctggaggccctgaag
gacctcatcaccgaggcgtgctgggatctgggatcaggcggcatcagcctgcaaagcatg
gactcctcgcacgtctccctggtgcagctcacgctgcgctctgagggcttcgacacctac
cgctgcgaccgcaacatcgccatgggcgtcaacctcaacagcatgtctaaaatactgaag
tgtgctggaaatgaagatatcataactctcagagcagaagacaatgcggatacattggct
ctagtgtttgaagcaccaaatcaggaaaaggtttctgattatgagatgaagcttatggac
ctcgatgtggagcagcttggaattccagaacaagaatacagttgtgtagtgaaaatgcct
tctgctgaatttgcacgcatctgcagagacctcagccacattggtgatgctgttgtcatc
tcctgtgcaaaagacggtgtgaaattttcagctaatggagagttaggaaatggaaacatc
aagctgtcacagaccagtaatgtggacaaagaggaagaagctgttacaatagaaatgaat
gagccagtccagttgacttttgctctgaggtatttgaacttctttaccaaagccaccccc
ctgtcacctacagtaacactcagcatgtctgcagatgttcctctggttgtggagtacaag
attgctgatatgggacacttaaaatactacctggctccaaagattgaagaccagcaagaa
ggctcttaa

DBGET integrated database retrieval system