Meleagris gallopavo (turkey): 104909450 Help Entry 104909450         CDS       T01523                                  Name (RefSeq) DNA polymerase delta subunit 3   KO K03504   DNA polymerase delta subunit 3 Organism mgp  Meleagris gallopavo (turkey) Pathway mgp03030   DNA replication mgp03410   Base excision repair mgp03420   Nucleotide excision repair mgp03430   Mismatch repair mgp03440   Homologous recombination Brite KEGG Orthology (KO) [BR:mgp00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     104909450    03410 Base excision repair     104909450    03420 Nucleotide excision repair     104909450    03430 Mismatch repair     104909450    03440 Homologous recombination     104909450  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mgp01009]     104909450   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:mgp03032]     104909450    03400 DNA repair and recombination proteins [BR:mgp03400]     104909450 Protein phosphatases and associated proteins [BR:mgp01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      104909450 DNA replication proteins [BR:mgp03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     104909450 DNA repair and recombination proteins [BR:mgp03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       104909450    MMR (mismatch excision repair)     DNA polymerase delta complex      104909450 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CDC27 CREPT PIG-L Motif Other DBs NCBI-GeneID:  104909450 NCBI-ProteinID:  XP_010704623 UniProt:  A0A803YPC9 LinkDB All DBs Position 1:complement(190479749..190488440) Genome browser AA seq 131 aa AA seqDB search MEDELYLENIDEFVTDQNRIVTYKWLSYTLGVHVNQAKQMLYDYVERKRKENSGAQLHVT YLVAGNLTQNGHTCHKVAVVREDKLEAVKSKLTTVTSVHVYSIQKALLKDSGPLYNTDYD IIKTNLHNCSK NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atggaggacgagctgtacctcgagaacatcgatgagttcgtcaccgaccagaaccgcatt gtgacatacaaatggctgagctatactctaggagtccacgtcaatcaggctaagcagatg ctgtatgattatgtggagaggaaacgaaaggagaactcaggagctcagcttcatgtcacc tacctggtagcaggaaacctcacccagaatggacatacatgccacaaggttgcagtagtg agagaggataagctggaagcagtgaagtctaaactgaccacggttaccagcgtgcatgtc tacagcattcagaaagccctgctcaaagacagcgggccgctctacaacacagactacgat atcatcaaaaccaacctgcacaactgcagcaagtga

DBGET integrated database retrieval system