Meleagris gallopavo (turkey): 104911269 Help Entry 104911269         CDS       T01523                                  Name (RefSeq) histone H3.3   KO K11253   histone H3 Organism mgp  Meleagris gallopavo (turkey) Brite KEGG Orthology (KO) [BR:mgp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mgp03036]     104911269   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mgp04147]     104911269 Chromosome and associated proteins [BR:mgp03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104911269 Exosome [BR:mgp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104911269 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  104911269 NCBI-ProteinID:  XP_010710352 LinkDB All DBs Position 1:46461399..46466662 Genome browser AA seq 88 aa AA seqDB search MKNIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDT NLCAIHAKRVTIMPKDIQLARRIRGERA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgaagaatatccgccgctaccagaagtccacggagctgctgatccgcaagctgcccttc cagcgcctggtgcgcgagatcgcgcaggacttcaagaccgacctgcgcttccagagctcg gccgtcatggcgctgcaggaggcgagcgaggcctacctggtggggctcttcgaggacacc aacctgtgtgccatccacgccaagcgcgtcaccatcatgcccaaggacatccagctcgcc cggcgcatccgcggggagcgcgcctga

DBGET integrated database retrieval system