Meleagris gallopavo (turkey): 104913646 Help Entry 104913646         CDS       T01523                                  Symbol PAXX Name (RefSeq) protein PAXX   KO K25772   protein PAXX Organism mgp  Meleagris gallopavo (turkey) Brite KEGG Orthology (KO) [BR:mgp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:mgp03400]     104913646 (PAXX) DNA repair and recombination proteins [BR:mgp03400]  Eukaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     Other NHEJ factors      104913646 (PAXX) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PAXX Motif Other DBs NCBI-GeneID:  104913646 NCBI-ProteinID:  XP_010718975 LinkDB All DBs Position 19:296542..298034 Genome browser AA seq 92 aa AA seqDB search AEARPQLQALLFAMAARVRDLEERLEVLGTLSYSPEKNTLQSQQPILPDPSPRKNRAAGS ALPAKRKIPGESLINPGFKSKSVPSGVDFEDS NT seq 279 nt NT seq  +upstreamnt  +downstreamnt gccgaggcgcggccgcagctccaagcgctgctgttcgccatggccgctcgcgtccgggac ctggaggagcgcttggaagtgctgggcacgctgagctacagccccgagaagaacaccctc cagagccagcagcccatcctgccagaccccagccccagaaagaacagggctgctggctcc gctttgccggcaaagagaaagatcccgggagagtccctcattaaccctggcttcaaaagc aagtctgttccatctggagtggactttgaagactcatga

DBGET integrated database retrieval system