Meleagris gallopavo (turkey): 104914532 Help Entry 104914532         CDS       T01523                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism mgp  Meleagris gallopavo (turkey) Pathway mgp04010   MAPK signaling pathway mgp04012   ErbB signaling pathway mgp04068   FoxO signaling pathway mgp04137   Mitophagy - animal mgp04140   Autophagy - animal mgp04150   mTOR signaling pathway mgp04210   Apoptosis mgp04218   Cellular senescence mgp04370   VEGF signaling pathway mgp04371   Apelin signaling pathway mgp04540   Gap junction mgp04625   C-type lectin receptor signaling pathway mgp04810   Regulation of actin cytoskeleton mgp04910   Insulin signaling pathway mgp04912   GnRH signaling pathway mgp04916   Melanogenesis Brite KEGG Orthology (KO) [BR:mgp00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104914532 (NRAS)    04012 ErbB signaling pathway     104914532 (NRAS)    04370 VEGF signaling pathway     104914532 (NRAS)    04371 Apelin signaling pathway     104914532 (NRAS)    04068 FoxO signaling pathway     104914532 (NRAS)    04150 mTOR signaling pathway     104914532 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104914532 (NRAS)    04137 Mitophagy - animal     104914532 (NRAS)   09143 Cell growth and death    04210 Apoptosis     104914532 (NRAS)    04218 Cellular senescence     104914532 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     104914532 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104914532 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104914532 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     104914532 (NRAS)    04912 GnRH signaling pathway     104914532 (NRAS)    04916 Melanogenesis     104914532 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mgp04131]     104914532 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mgp04147]     104914532 (NRAS)    04031 GTP-binding proteins [BR:mgp04031]     104914532 (NRAS) Membrane trafficking [BR:mgp04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     104914532 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     104914532 (NRAS) Exosome [BR:mgp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104914532 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    104914532 (NRAS)   Exosomal proteins of breast cancer cells    104914532 (NRAS)   Exosomal proteins of colorectal cancer cells    104914532 (NRAS) GTP-binding proteins [BR:mgp04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104914532 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc RsgA_GTPase IL23 FeoB_N GTP_EFTU TPP_enzyme_M Alpha-amylase_C_2 Motif Other DBs NCBI-GeneID:  104914532 NCBI-ProteinID:  XP_010722671 LinkDB All DBs Position 28:complement(4537131..4538377) Genome browser AA seq 94 aa AA seqDB search MRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVD TKQAQELAKSYGIPFIETSAKTRQVRCFCSLALC NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgcgagatcagtacatgagaactggggaaggattcctttgtgtgtttgccattaacaac agtaaatcattcgctgatattaacctttacagagagcaaatcaagagagtgaaagactca gacgatgtgccaatggtgctggttgggaataagtgtgatttgcccacaaggacagtagat acaaaacaggctcaagaattagcaaaaagttatggcattcccttcatagagacatcagct aaaacgagacaggtaagatgtttctgttctttggctctatgttaa

DBGET integrated database retrieval system