KEGG   Meleagris gallopavo (turkey): 104915812
Entry
104915812         CDS       T01523                                 

Gene name
APEX1
Definition
(RefSeq) DNA-(apurinic or apyrimidinic site) lyase
  KO
K10771  AP endonuclease 1 [EC:4.2.99.18]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    104915812 (APEX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mgp03400]
    104915812 (APEX1)
Enzymes [BR:mgp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     104915812 (APEX1)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     104915812 (APEX1)
SSDB
Motif
Pfam: Exo_endo_phos Exo_endo_phos_2
Other DBs
NCBI-GeneID: 104915812
NCBI-ProteinID: XP_010725040
LinkDB
Position
Unknown
AA seq 173 aa
TPGIEEHDSEGRVLTAEFPSFYIVSAYVPNSGRGLTRLQYRQRWDEAFKDFLLALDSQKP
VVLCGDLNVAHQEIDLRNPKNNRRSAGFTQEERDGFGALLNAGFLDSFRELYPTVPHAYT
FWTYMGGARQRNVGWRLDYFLLSKRLGSALCDSKIRSAAMGSDHCPITLYLAV
NT seq 522 nt   +upstreamnt  +downstreamnt
accccaggcatcgaggaacacgactccgagggccgcgtcctgacggccgaattcccatct
ttttacatcgtttccgcctacgtcccgaattcgggtcggggtctgacccgcctccaatac
cgccaacgttgggacgaagcctttaaagatttcctcctggctctggattcccaaaaaccc
gtggtcctttgcggggatctgaacgtggcccatcaagaaatcgatctccggaatcccaaa
aacaaccggcgttcggccggcttcacccaggaagagagggatggattcggggctctgctc
aacgccggcttcctggattcgtttcgggagctttaccccaccgtgccccacgcctacacc
ttctggacctacatggggggagccaggcagcgcaacgtgggctggaggttggattatttc
ctcctctccaagcgtttgggatcggcgctgtgcgactccaagatccgatccgcggccatg
ggaagcgatcactgccccattacgctctacctggctgtgtaa

DBGET integrated database retrieval system