Meleagris gallopavo (turkey): 104916518 Help Entry 104916518         CDS       T01523                                  Name (RefSeq) riboflavin kinase-like   KO K00861   riboflavin kinase [EC:2.7.1.26] Organism mgp  Meleagris gallopavo (turkey) Pathway mgp00740   Riboflavin metabolism mgp01100   Metabolic pathways mgp01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:mgp00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00740 Riboflavin metabolism     104916518 Enzymes [BR:mgp01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.1  Phosphotransferases with an alcohol group as acceptor     2.7.1.26  riboflavin kinase      104916518 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Flavokinase Motif Other DBs NCBI-GeneID:  104916518 NCBI-ProteinID:  XP_010725857 LinkDB All DBs Position Unknown AA seq 77 aa AA seqDB search ETHIIHTFKEDFYGEILSIAIIGYIRPEKNFDSLDALIAAIQEDIEEAKRQLDLPEHLKL KEDNFFHLPGGKIVDNH NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gagacgcacattatccacaccttcaaagaagacttctatggagaaattcttagtatagca attattggatatattcgaccagaaaagaactttgattccttagatgcgctgattgcggca attcaggaggacattgaagaggcaaaaagacaactagatttaccagaacatcttaaactc aaagaagacaacttctttcatcttccagggggcaaaatagttgacaaccactga

DBGET integrated database retrieval system