Meleagris gallopavo (turkey): 104917010 Help Entry 104917010         CDS       T01523                                  Name (RefSeq) peptide YY-like   KO K05233   peptide YY Organism mgp  Meleagris gallopavo (turkey) Pathway mgp04080   Neuroactive ligand-receptor interaction Brite KEGG Orthology (KO) [BR:mgp00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     104917010  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mgp04052]     104917010 Cytokines and neuropeptides [BR:mgp04052]  Neuropeptides   GPCR binding    104917010 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hormone_3 Motif Other DBs NCBI-GeneID:  104917010 NCBI-ProteinID:  XP_010726378 UniProt:  A0A803Y7Z6 LinkDB All DBs Position Unknown AA seq 90 aa AA seqDB search MPLAPLRVLPALALCALLCAAAYPPKPENPGDAASPEEIAQYFSALRHYINLVTRQRYGK RSSSVPAVLVQPVGPRSDALWSDIDDDSAW NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgcctctggccccgctccgcgttctgcccgccttggcgctttgcgcgctgctgtgcgcg gccgcgtatccgccgaaacccgaaaaccccggagacgcggcgtcgcccgaggagatcgcg cagtatttctccgcgctgcgccattacatcaacctggtcacacggcagcggtatgggaag cgcagcagctccgtgcctgcagtgttggtgcagcccgtgggtccccgcagtgatgcactg tggtccgacatcgatgacgactccgcctggtga

DBGET integrated database retrieval system