Meleagris gallopavo (turkey): 5848001 Help Entry 5848001           CDS       T01523                                  Symbol ND4L Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism mgp  Meleagris gallopavo (turkey) Pathway mgp00190   Oxidative phosphorylation mgp01100   Metabolic pathways Module mgp_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:mgp00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     5848001 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:mgp03029]     5848001 (ND4L) Enzymes [BR:mgp01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      5848001 (ND4L) Mitochondrial biogenesis [BR:mgp03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     5848001 (ND4L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q2 DUF6198 DUF5976 Motif Other DBs NCBI-GeneID:  5848001 NCBI-ProteinID:  YP_004243716 UniProt:  A9XBE7 LinkDB All DBs Position MT:9975..10271 Genome browser AA seq 98 aa AA seqDB search MSPLHFSFYSAFTFSSLGLAFHRTHLISALLCLESMMLSMFIPLSMWSIENQTPSFTLVP ILMLAFSACEAATGLAMLVASTRTYGSDHLHNLNLLQC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtctcccttacacttcagcttctattccgcattcacattcagcagcctaggcctagca tttcaccgaacccatcttatctccgctctactatgtctagaaagcatgatactatccata ttcattcccctatcaatatgatcaatcgaaaaccaaaccccatccttcaccctagtacca atcctaatactagccttctcagcatgcgaagctgccaccggcctagccatgctagtagcc tcaacccgaacatatggctccgaccacttacataatctcaacctcctacaatgttaa

DBGET integrated database retrieval system